1FUGA

S-adenosylmethionine synthetase
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 11-266 256 1-10, 267-383 10 117 knot
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 17-279 263 1-16 346-383 280-345 16 38 slipknot
view details
2.1 20-362 343 363-383 1-4 5-19 4 20 slipknot
view details
2.1 16-259 244 1-6, 274-383 7-15, 260-273 6 110 slipknot
view details
2.1 17-350 334 1-6, 363-383 7-16, 351-362 6 21 slipknot
publication title Flexible loop in the structure of S-adenosylmethionine synthetase crystallized in the tetragonal modification.
pubmed rcsb
structure length 383
molecule tags Transferase
source organism Escherichia coli
sequence length 383
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-02-25
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1fugA01
1P7LA 2OBVA 1MXBA 2P02A 1XRCA 1MXAA 3IMLA 1O92A 1RG9A 1FUGA 1O93A 1O9TA 1XRAA 1O90A 1MXCA 1XRBA 1QM4A
chains in the KnotProt database with same CATH superfamily
1P7LA 2OBVA 1MXBA 2P02A 1XRCA 1MXAA 3IMLA 1O92A 1RG9A 1FUGA 1O93A 1O9TA 1XRAA 1O90A 1MXCA 1XRBA 1QM4A
chains in the KnotProt database with same CATH topology
1P7LA 2OBVA 1MXBA 2P02A 1XRCA 1MXAA 3IMLA 1O92A 1RG9A 1FUGA 1O93A 1O9TA 1XRAA 1O90A 1MXCA 1XRBA 1QM4A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1P7L A;  2OBV A;  1MXB A;  2P02 A;  1XRC A;  1MXA A;  3IML A;  1O92 A;  1RG9 A;  1FUG A;  1O93 A;  1O9T A;  1XRA A;  1O90 A;  1MXC A;  1XRB A;  1QM4 A; 
#chains in the KnotProt database with same CATH topology
 1P7L A;  2OBV A;  1MXB A;  2P02 A;  1XRC A;  1MXA A;  3IML A;  1O92 A;  1RG9 A;  1FUG A;  1O93 A;  1O9T A;  1XRA A;  1O90 A;  1MXC A;  1XRB A;  1QM4 A; 
#chains in the KnotProt database with same CATH homology
 1P7L A;  2OBV A;  1MXB A;  2P02 A;  1XRC A;  1MXA A;  3IML A;  1O92 A;  1RG9 A;  1FUG A;  1O93 A;  1O9T A;  1XRA A;  1O90 A;  1MXC A;  1XRB A;  1QM4 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling