1MXAA

S-adenosylmethionine synthetase with ppi
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 17-265 249 1-16, 266-383 16 118 knot
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPD------RADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 18-270 253 1-17 335-377 271-334 17 43 slipknot
view details
1.1 18-236 219 1-4, 249-377 5-17, 237-248 4 129 slipknot
view details
2.1 19-360 342 361-377 1-4 5-18 4 16 slipknot
sequence length 383
structure length 377
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
missing residues 102-107
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA01
1P7LA 2OBVA 1MXBA 2P02A 1XRCA 1MXAA 3IMLA 1O92A 1RG9A 1FUGA 1O93A 1O9TA 1XRAA 1O90A 1MXCA 1XRBA 1QM4A
chains in the KnotProt database with same CATH superfamily
1P7LA 2OBVA 1MXBA 2P02A 1XRCA 1MXAA 3IMLA 1O92A 1RG9A 1FUGA 1O93A 1O9TA 1XRAA 1O90A 1MXCA 1XRBA 1QM4A
chains in the KnotProt database with same CATH topology
1P7LA 2OBVA 1MXBA 2P02A 1XRCA 1MXAA 3IMLA 1O92A 1RG9A 1FUGA 1O93A 1O9TA 1XRAA 1O90A 1MXCA 1XRBA 1QM4A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1P7L A;  2OBV A;  1MXB A;  2P02 A;  1XRC A;  1MXA A;  3IML A;  1O92 A;  1RG9 A;  1FUG A;  1O93 A;  1O9T A;  1XRA A;  1O90 A;  1MXC A;  1XRB A;  1QM4 A; 
#chains in the KnotProt database with same CATH topology
 1P7L A;  2OBV A;  1MXB A;  2P02 A;  1XRC A;  1MXA A;  3IML A;  1O92 A;  1RG9 A;  1FUG A;  1O93 A;  1O9T A;  1XRA A;  1O90 A;  1MXC A;  1XRB A;  1QM4 A; 
#chains in the KnotProt database with same CATH homology
 1P7L A;  2OBV A;  1MXB A;  2P02 A;  1XRC A;  1MXA A;  3IML A;  1O92 A;  1RG9 A;  1FUG A;  1O93 A;  1O9T A;  1XRA A;  1O90 A;  1MXC A;  1XRB A;  1QM4 A; 
5A1IA 2P02A 4ODJA 5T8SA 3S82A 3TDEA 4LE5A 2OBVA 3RV2A 5T8TA 4NDNA 4NDNB 4NDNC 4NDND 3IMLA 5H9UA 1RG9A 1P7LA 1MXAA 4KTTA 4KTTB 4KTTC 4KTTD 1MXBA 1MXCA 1QM4A 1XRBA 1XRAA 1XRCA 4KTVA 4KTVB 4KTVC 4KTVD 1FUGA 3SO4A 1O9TA 1O90A 1O92A 1O93A
similar chains in the KnotProt database (40% sequence similarity)
5T8SB 5A1GA 3S82B 3TDEB 3TDEC 3TDED 4LE5B 3RV2B 5UGHA 5UGHB 5UGHC 5UGHD 5T8TB 5A19A 3IMLB 3IMLC 3IMLD 5H9UB 5H9UC 5H9UD 1RG9B 1RG9C 1RG9D 1P7LB 1P7LC 1P7LD 1QM4B 1FUGB 3SO4B 3SO4C 3SO4D 1O9TB 1O90B 1O92B 1O93B
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5A1I A;  2P02 A;  4ODJ A;  5T8S A;  3S82 A;  3TDE A;  4LE5 A;  2OBV A;  3RV2 A;  5T8T A;  4NDN A;  4NDN B;  4NDN C;  4NDN D;  3IML A;  5H9U A;  1RG9 A;  1P7L A;  1MXA A;  4KTT A;  4KTT B;  4KTT C;  4KTT D;  1MXB A;  1MXC A;  1QM4 A;  1XRB A;  1XRA A;  1XRC A;  4KTV A;  4KTV B;  4KTV C;  4KTV D;  1FUG A;  3SO4 A;  1O9T A;  1O90 A;  1O92 A;  1O93 A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5T8S B;  5A1G A;  3S82 B;  3TDE B;  3TDE C;  3TDE D;  4LE5 B;  3RV2 B;  5UGH A;  5UGH B;  5UGH C;  5UGH D;  5T8T B;  5A19 A;  3IML B;  3IML C;  3IML D;  5H9U B;  5H9U C;  5H9U D;  1RG9 B;  1RG9 C;  1RG9 D;  1P7L B;  1P7L C;  1P7L D;  1QM4 B;  1FUG B;  3SO4 B;  3SO4 C;  3SO4 D;  1O9T B;  1O90 B;  1O92 B;  1O93 B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling