1OSNA

Crystal structure of varicella zoster virus thymidine kinase in complex with bvdu-mp and adp
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 6-123 118 1-5 311-331 124-310 5 21 slipknot
Chain Sequence
VKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPNRILLIGEPLSYWRNLAGEDAICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDTSTSDLVQVNKEPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSHLSRVS------ETVNLPFVMVLRNVYIMLINTIIFLKTNNWHAGWNTLSFCNDVFKQKLQKSECIKLREVPGIEDTLFAVLKLPELCGEFGNILPLWAWGMETLSNCLRSMSPFVLSLEQTPQHAAQELKTLLPQMTPANMSSGAWNILKELVNAVQD
sequence length 331
structure length 325
publication title Crystal structure of varicella zoster virus thymidine kinase
pubmed doi rcsb
molecule tags Transferase
molecule keywords Thymidine kinase
source organism Human herpesvirus 3
missing residues 179-184
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date2003-03-20
KnotProt deposition date2014-07-31

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
A PF00693 Herpes_TKThymidine kinase from herpesvirus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1osnA00
3RDPA 1E2NA 1KI6A 4IVPA 1VTKA 1KI6B 3F0TA 1E2HA 1KI4A 1QHIA 1OF1A 4JBXA 1E2IA 1KI3A 1P75A 2VTKA 1F48A 1E2LA 1KI8A 4IVRA 1E2PA 4JBYA 1E2JA 1KI2A 1P72A 1E2KA 1P7CA 2KI5A 1E2MA 1KI7A 4IVQA 1KIMA 1P6XA 1OSNA 1P73A 3VTKA
chains in the KnotProt database with same CATH superfamily
3RDPA 3M4NA 3FSGA 3L04A 1E2NA 1KI6A 4IVPA 3KZKA 1QMGA 3KZCA 3L02A 2FG7C 1VTKA 4JBXA 3FR8A 2FG6C 2G7MC 1KI6B 3F0TA 1LNSA 1E2HA 1KI4A 1JS1X 3KZMA 3M5DA 3FR7A 1QHIA 1YRLA 1OF1A 3M5CA 3L05A 4IVRA 1E2IA 1KI3A 1P75A 2VTKA 1YH1A 1F48A 1YVEI 1E2LA 1KI8A 3M4JA 2XTJA 1E2PA 4JBYA 2FG7X 1E2JA 1KI2A 1P72A 1E2KA 3KZOA 1P7CA 2KI5A 3L06A 1E2MA 1KI7A 4IVQA 1KIMA 1P6XA 3VTKA 1OSNA 1P73A 3KZNA
chains in the KnotProt database with same CATH topology
3RDPA 1E2NA 1KI6A 4IVPA 1VTKA 1KI6B 3F0TA 1E2HA 1KI4A 1QHIA 1OF1A 4JBXA 1E2IA 1KI3A 1P75A 2VTKA 1F48A 1E2LA 1KI8A 4IVRA 1E2PA 4JBYA 1E2JA 1KI2A 1P72A 1E2KA 1P7CA 2KI5A 1E2MA 1KI7A 4IVQA 1KIMA 1P6XA 1OSNA 1P73A 3VTKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3RDP A;  1E2N A;  1KI6 A;  4IVP A;  1VTK A;  1KI6 B;  3F0T A;  1E2H A;  1KI4 A;  1QHI A;  1OF1 A;  4JBX A;  1E2I A;  1KI3 A;  1P75 A;  2VTK A;  1F48 A;  1E2L A;  1KI8 A;  4IVR A;  1E2P A;  4JBY A;  1E2J A;  1KI2 A;  1P72 A;  1E2K A;  1P7C A;  2KI5 A;  1E2M A;  1KI7 A;  4IVQ A;  1KIM A;  1P6X A;  1OSN A;  1P73 A;  3VTK A; 
#chains in the KnotProt database with same CATH topology
 3RDP A;  3M4N A;  3FSG A;  3L04 A;  1E2N A;  1KI6 A;  4IVP A;  3KZK A;  1QMG A;  3KZC A;  3L02 A;  2FG7 C;  1VTK A;  4JBX A;  3FR8 A;  2FG6 C;  2G7M C;  1KI6 B;  3F0T A;  1LNS A;  1E2H A;  1KI4 A;  1JS1 X;  3KZM A;  3M5D A;  3FR7 A;  1QHI A;  1YRL A;  1OF1 A;  3M5C A;  3L05 A;  4IVR A;  1E2I A;  1KI3 A;  1P75 A;  2VTK A;  1YH1 A;  1F48 A;  1YVE I;  1E2L A;  1KI8 A;  3M4J A;  2XTJ A;  1E2P A;  4JBY A;  2FG7 X;  1E2J A;  1KI2 A;  1P72 A;  1E2K A;  3KZO A;  1P7C A;  2KI5 A;  3L06 A;  1E2M A;  1KI7 A;  4IVQ A;  1KIM A;  1P6X A;  3VTK A;  1OSN A;  1P73 A;  3KZN A; 
#chains in the KnotProt database with same CATH homology
 3RDP A;  1E2N A;  1KI6 A;  4IVP A;  1VTK A;  1KI6 B;  3F0T A;  1E2H A;  1KI4 A;  1QHI A;  1OF1 A;  4JBX A;  1E2I A;  1KI3 A;  1P75 A;  2VTK A;  1F48 A;  1E2L A;  1KI8 A;  4IVR A;  1E2P A;  4JBY A;  1E2J A;  1KI2 A;  1P72 A;  1E2K A;  1P7C A;  2KI5 A;  1E2M A;  1KI7 A;  4IVQ A;  1KIM A;  1P6X A;  1OSN A;  1P73 A;  3VTK A; 
1OSNA
similar chains in the KnotProt database (40% sequence similarity)
1OSNB 1OSNC 1OSND
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 1OSN A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1OSN B;  1OSN C;  1OSN D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling