1GV4A

Murine apoptosis-inducing factor (aif)
Slipknot S -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 381-460 80 1-380 488-490 461-487 380 3 slipknot
Chain Sequence
TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 387-482 96 1-386, 483-490 386 8 knot
view details
2.1m 387-457 71 1-386 468-490 458-467 386 23 slipknot
sequence length 490
structure length 490
publication title The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROGRAMED CELL DEATH PROTEIN 8
source organism Mus musculus
ec nomenclature
pdb deposition date 2002-02-05
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1gv4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1gv4A02
1GV4A
chains in the KnotProt database with same CATH superfamily
1GV4A
chains in the KnotProt database with same CATH topology
1GV4A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1GV4 A; 
#chains in the KnotProt database with same CATH topology
 1GV4 A; 
#chains in the KnotProt database with same CATH homology
 1GV4 A; 
4LIIA 4BV6A 1GV4A 1M6IA 3GD4A 5KVHA 4BURA 4BURB 4BURC 4BURD 4FDCB 5MIVA 3GD3A 5MIUA
similar chains in the KnotProt database (40% sequence similarity)
5FS8A 5FS9A 5FS9B 5FMHA 5FS7A 5FS7B 5FS6A 5FS6B 5KVIA 1GV4B 3GD4B 5KVHB 5MIVC 3GD3B 3GD3C 3GD3D 5MIUB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4LII A;  4BV6 A;  1GV4 A; 
               
               
#similar chains, but unknotted
 1M6I A;  3GD4 A;  5KVH A;  4BUR A;  4BUR B;  4BUR C;  4BUR D;  4FDC B;  5MIV A;  3GD3 A;  5MIU A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5FS8 A;  5FS9 A;  5FS9 B;  5FMH A;  5FS7 A;  5FS7 B;  5FS6 A;  5FS6 B;  5KVI A;  1GV4 B;  3GD4 B;  5KVH B;  5MIV C;  3GD3 B;  3GD3 C;  3GD3 D;  5MIU B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling