1HYNP

Crystal structure of the cytoplasmic domain of human erythrocyte band-3 protein
Slipknot S -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 38-181 144 1-33, 221-293 34-37, 182-220 33 73 slipknot
Chain Sequence
KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ
sequence length 293
structure length 293
publication title Crystallographic structure and functional interpretation of the cytoplasmic domain of erythrocyte membrane band 3.
pubmed rcsb
molecule tags Membrane protein
molecule keywords BAND 3 ANION TRANSPORT PROTEIN
source organism Homo sapiens
ec nomenclature
pdb deposition date 2001-01-20
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF07565 Band_3_cyto Band 3 cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 7-177 171 1-1, 185-293 2-6, 178-184 1 109 slipknot
view details
2.1m 27-178 152 1-22, 185-293 23-26, 179-184 22 109 slipknot
view details
2.1m 41-175 135 1-30, 188-293 31-40, 176-187 30 106 slipknot
view details
2.1m 41-212 172 1-31, 226-293 32-40, 213-225 31 68 slipknot
cath code
ClassArchitectureTopologyHomologyDomain
3.40.930.10 Alpha Beta 3-Layer(aba) Sandwich Mannitol-specific EII; Chain A Mannitol-specific EII; Chain A 1hynP00
1HYNP
chains in the KnotProt database with same CATH superfamily
1HYNP
chains in the KnotProt database with same CATH topology
1HYNP
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1HYN P; 
#chains in the KnotProt database with same CATH topology
 1HYN P; 
#chains in the KnotProt database with same CATH homology
 1HYN P; 
1HYNP
similar chains in the KnotProt database (40% sequence similarity)
1HYNQ 1HYNR 1HYNS
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 1HYN P; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1HYN Q;  1HYN R;  1HYN S; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling