1WQBA

Three-dimensional solution strucutre of aptotoxin vii, from the venom of a trap-door spider
Cysteine knot
Loop Piercing
view details
4-c-11-b-24-c-19 18-b-29
Chain Sequence
WLGCARVKEACGPWEWPCCSGLKCDGSECHPQ
sequence length 32
structure length 32
publication title Three-dimensional Solution Structure of Aptotoxin VII, from the Venom of a Trap-door Spider
rcsb
molecule tags Toxin
molecule keywords Aptotoxin VII
ec nomenclature
pdb deposition date 2004-09-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling