2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 174-239 66 1-173, 240-320 173 81 knot
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
sequence length 320
structure length 320
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
ec nomenclature ec 2.1.3.-:
pdb deposition date2005-12-21
KnotProt deposition date2014-10-08

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
C PF02729 OTCace_NAspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
C PF02729.16 OTCace_NAspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
C PF00185.19 OTCaceAspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg7C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg7C01
3L02A 3M4NA 2FG7X 2FG7C 3L04A 3KZCA 3L06A 3M5CA 3KZOA 2FG6C 3KZKA 3M5DA 1YH1A 3KZNA 3L05A 1JS1X 2G7MC 3M4JA 3KZMA
chains in the KnotProt database with same CATH superfamily
3RDPA 3M4NA 3FSGA 3L04A 1E2NA 1KI6A 4IVPA 3KZKA 1QMGA 3KZCA 3L02A 2FG7C 1VTKA 4JBXA 3FR8A 2FG6C 2G7MC 1KI6B 3F0TA 1LNSA 1E2HA 1KI4A 1JS1X 3KZMA 3M5DA 3FR7A 1QHIA 1YRLA 1OF1A 3M5CA 3L05A 4IVRA 1E2IA 1KI3A 1P75A 2VTKA 1YH1A 1F48A 1YVEI 1E2LA 1KI8A 3M4JA 2XTJA 1E2PA 4JBYA 2FG7X 1E2JA 1KI2A 1P72A 1E2KA 3KZOA 1P7CA 2KI5A 3L06A 1E2MA 1KI7A 4IVQA 1KIMA 1P6XA 3VTKA 1OSNA 1P73A 3KZNA
chains in the KnotProt database with same CATH topology
3M4NA 3FSGA 3KZKA 3L02A 2FG7C 2FG6C 1LNSA 3M5CA 1JS1X 3KZMA 3M5DA 3KZCA 3L05A 3L04A 2XTJA 1YH1A 3KZNA 3M4JA 2FG7X 2G7MC 3KZOA 3L06A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3L02 A;  3M4N A;  2FG7 X;  2FG7 C;  3L04 A;  3KZC A;  3L06 A;  3M5C A;  3KZO A;  2FG6 C;  3KZK A;  3M5D A;  1YH1 A;  3KZN A;  3L05 A;  1JS1 X;  2G7M C;  3M4J A;  3KZM A; 
#chains in the KnotProt database with same CATH topology
 3RDP A;  3M4N A;  3FSG A;  3L04 A;  1E2N A;  1KI6 A;  4IVP A;  3KZK A;  1QMG A;  3KZC A;  3L02 A;  2FG7 C;  1VTK A;  4JBX A;  3FR8 A;  2FG6 C;  2G7M C;  1KI6 B;  3F0T A;  1LNS A;  1E2H A;  1KI4 A;  1JS1 X;  3KZM A;  3M5D A;  3FR7 A;  1QHI A;  1YRL A;  1OF1 A;  3M5C A;  3L05 A;  4IVR A;  1E2I A;  1KI3 A;  1P75 A;  2VTK A;  1YH1 A;  1F48 A;  1YVE I;  1E2L A;  1KI8 A;  3M4J A;  2XTJ A;  1E2P A;  4JBY A;  2FG7 X;  1E2J A;  1KI2 A;  1P72 A;  1E2K A;  3KZO A;  1P7C A;  2KI5 A;  3L06 A;  1E2M A;  1KI7 A;  4IVQ A;  1KIM A;  1P6X A;  3VTK A;  1OSN A;  1P73 A;  3KZN A; 
#chains in the KnotProt database with same CATH homology
 3M4N A;  3FSG A;  3KZK A;  3L02 A;  2FG7 C;  2FG6 C;  1LNS A;  3M5C A;  1JS1 X;  3KZM A;  3M5D A;  3KZC A;  3L05 A;  3L04 A;  2XTJ A;  1YH1 A;  3KZN A;  3M4J A;  2FG7 X;  2G7M C;  3KZO A;  3L06 A; 
1JS1X 2FG6C 2FG7C 2FG7X 2G7MC
similar chains in the KnotProt database (40% sequence similarity)
1JS1Y 1JS1Z 2FG6D 2FG6E 2FG6X 2FG6Y 2FG6Z 2FG7D 2FG7E 2FG7Y 2FG7Z 2G7MD 2G7ME 2G7MX 2G7MY 2G7MZ
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 1JS1 X;  2FG6 C;  2FG7 C;  2FG7 X;  2G7M C; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1JS1 Y;  1JS1 Z;  2FG6 D;  2FG6 E;  2FG6 X;  2FG6 Y;  2FG6 Z;  2FG7 D;  2FG7 E;  2FG7 Y;  2FG7 Z;  2G7M D;  2G7M E;  2G7M X;  2G7M Y;  2G7M Z; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling