2G7MC

Crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 174-239 66 1-173, 240-320 173 81 knot
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKEEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 173-283 111 1-172, 284-320 172 37 knot
view details
3.1 173-239 67 1-172 284-320 240-283 172 37 slipknot
view details
2.1 171-236 66 1-24, 240-320 25-170, 237-239 24 81 slipknot
view details
2.1 175-287 113 1-172, 300-320 173-174, 288-299 172 21 slipknot
view details
3.1 175-306 132 1-172, 314-320 173-174, 307-313 172 7 slipknot
view details
3.1 175-314 140 1-172, 320-320 173-174, 315-319 172 1 slipknot
view details
3.1 175-319 145 320-320 1-172 173-174 172 0 slipknot
publication title A single mutation in the active site swaps the substrate specificity of N-acetyl-L-ornithine transcarbamylase and N-succinyl-L-ornithine transcarbamylase.
pubmed doi rcsb
structure length 320
molecule tags Transferase
source organism Bacteroides fragilis
sequence length 320
molecule keywords putative ornithine carbamoyltransferase
ec nomenclature ec 2.1.3.-:
pdb deposition date 2006-02-28
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g7mC02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g7mC01
3L02A 3M4NA 2FG7X 2FG7C 3L04A 3KZCA 3L06A 3M5CA 3KZOA 2FG6C 3KZKA 3M5DA 1YH1A 3KZNA 3L05A 1JS1X 2G7MC 3M4JA 3KZMA
chains in the KnotProt database with same CATH superfamily
3RDPA 3M4NA 3FSGA 3L04A 1E2NA 1KI6A 4IVPA 3KZKA 1QMGA 3KZCA 1DBIA 1R4MB 3L02A 2FG7C 1VTKA 1GKUB 4JBXA 3FR8A 1II9A 2FG6C 2G7MC 1KI6B 3F0TA 1LNSA 1E2HA 1KI4A 1JS1X 3KZMA 3M5DA 3FR7A 1QHIA 1YRLA 1OF1A 3M5CA 3L05A 4IVRA 1E2IA 1KI3A 1P75A 2VTKA 1YH1A 1F48A 1YVEI 1E2LA 1KI8A 3M4JA 2XTJA 1E2PA 4JBYA 2FG7X 1E2JA 1KI2A 1P72A 1E2KA 3KZOA 1P7CA 2KI5A 3L06A 1E2MA 1KI7A 4IVQA 1R4NB 1KIMA 1P6XA 3VTKA 1OSNA 1P73A 3KZNA
chains in the KnotProt database with same CATH topology
3M4NA 3FSGA 3KZKA 1DBIA 3L02A 2FG7C 1GKUB 2FG6C 1LNSA 3M5CA 1JS1X 3KZMA 3M5DA 3KZCA 3L05A 3L04A 2XTJA 1YH1A 3KZNA 3M4JA 2FG7X 2G7MC 3KZOA 3L06A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3L02 A;  3M4N A;  2FG7 X;  2FG7 C;  3L04 A;  3KZC A;  3L06 A;  3M5C A;  3KZO A;  2FG6 C;  3KZK A;  3M5D A;  1YH1 A;  3KZN A;  3L05 A;  1JS1 X;  2G7M C;  3M4J A;  3KZM A; 
#chains in the KnotProt database with same CATH topology
 3RDP A;  3M4N A;  3FSG A;  3L04 A;  1E2N A;  1KI6 A;  4IVP A;  3KZK A;  1QMG A;  3KZC A;  1DBI A;  1R4M B;  3L02 A;  2FG7 C;  1VTK A;  1GKU B;  4JBX A;  3FR8 A;  1II9 A;  2FG6 C;  2G7M C;  1KI6 B;  3F0T A;  1LNS A;  1E2H A;  1KI4 A;  1JS1 X;  3KZM A;  3M5D A;  3FR7 A;  1QHI A;  1YRL A;  1OF1 A;  3M5C A;  3L05 A;  4IVR A;  1E2I A;  1KI3 A;  1P75 A;  2VTK A;  1YH1 A;  1F48 A;  1YVE I;  1E2L A;  1KI8 A;  3M4J A;  2XTJ A;  1E2P A;  4JBY A;  2FG7 X;  1E2J A;  1KI2 A;  1P72 A;  1E2K A;  3KZO A;  1P7C A;  2KI5 A;  3L06 A;  1E2M A;  1KI7 A;  4IVQ A;  1R4N B;  1KIM A;  1P6X A;  3VTK A;  1OSN A;  1P73 A;  3KZN A; 
#chains in the KnotProt database with same CATH homology
 3M4N A;  3FSG A;  3KZK A;  1DBI A;  3L02 A;  2FG7 C;  1GKU B;  2FG6 C;  1LNS A;  3M5C A;  1JS1 X;  3KZM A;  3M5D A;  3KZC A;  3L05 A;  3L04 A;  2XTJ A;  1YH1 A;  3KZN A;  3M4J A;  2FG7 X;  2G7M C;  3KZO A;  3L06 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling