3TVNX

Human carbonic anhydrase ii proton transfer mutant
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 26-254 229 1-25, 255-258 25 4 knot
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
sequence length 258
structure length 258
publication title Water Networks in Fast Proton Transfer during Catalysis by Human Carbonic Anhydrase II.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date2011-09-20
KnotProt deposition date2014-07-31

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
X PF00194 Carb_anhydraseEukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 3tvnX00
1Z9YA 2X7SA 3N3JA 1CCUA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 1ZGFA 3T84A 3DVCA 2CBAA 2X7TA 1CAIA 3V3JA 3TVOX 3MHOA 3RG3A 1RAYA 1BN3A 1OQ5A 1AM6A 1I9NA 1RZDA 3S9TA 1H9QA 3S76A 4FL7A 1MUAA 3KOIA 1DMYA 1FQRA 1FR4A 3S73B 1BNWA 3P55A 1KOQA 1XEGA 9CA2A 3PJJA 4E3FA 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 3NB5A 3RZ5A 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 3QYKA 2F14A 3M2XA 4G0CA 2NNVA 1I9MA 3M5EA 2Q1QA 4E49A 1BNVA 1BZMA 2FOYA 3MNUA 3N0NA 3K34A 3CZVA 2AX2A 1UGCA 1XPZA 3V3HB 1OKLA 3DC3A 3HS4A 3MNAA 1UGDA 3U45X 3CA2A 2NWPA 2HD6A 3ML2A 1BN1A 3RZ1B 1HCAA 3OKUA 3KONA 3P3JA 4E3DA 3JXHC 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3K7KA 3HKQA 1A42A 1ZH9A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 2QOAA 1UGBA 1CNBA 1H9NA 3IBLA 3RYYA 2CA2A 1IF4A 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 3OYQA 1Y7WA 3F8EA 1J9WA 3S71B 3KIGA 3M3XA 3LXEA 4BCWA 3RZ0B 3SAPA 3V3IB 1UGAA 1CNCA 2IT4A 3RG4A 2CBEA 1CAZA 1IF5A 3S78B 3DA2A 1YDDA 12CAA 2HKKA 1G46A 1ZFKA 3PYKA 1ZSBA 2WEGA 3S74B 3CYUA 4FIKA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3V5GA 3OIMA 1HUGA 3EFTA 1G54A 3FFPX 3W6IA 2CBCA 1TB0X 3HLJA 1CA3A 8CA2A 1XQ0A 3KNEA 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 3SAXA 3V3GB 1CNKA 2O4ZA 3M96A 4E4AA 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 3T5ZA 1TBTX 1LZVA 1ZE8A 3M04A 1ZFQA 2FOVA 2NXRA 3OILA 1HUHA 3U7CA 1G53A 1FQMA 2CBBA 2Q1BA 1MOOA 3K2FA 1UGGA 1CNYA 2NWOA 3MHCA 1YDCA 3RLDA 3RYXB 1CRAA 3MNKA 3IEOA 1IF7A 3U3AX 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 3RGEA 3V2JA 1G4JA 3PO6A 1G6VA 3RYJB 2ABEA 1CVFA 2GEHA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 4ILXA 3DCCA 3T5UA 3P3HA 2WD3A 1BCDA 1CNIA 1T9NA 1FQLA 3M2NA 1BN4A 3S72B 3P5AA 3V2MA 1YO2A 3JXFA 3V7XA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 3OY0A 1LG5A 3SBHA 3UYNA 4E3GA 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 1TEQX 2CABA 2QO8A 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3M14A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 4IDRX 1CANA 2HOCA 1HECA 3FW3A 2H4NA 2POVA 3M40A 1CRMA 3TVNX 1HVAA 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 3V3FA 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1CVBA 3M1KA 1G0FA 3RZ7A 2NNOA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3D9ZA 3S77B 3W6HA 3IBUA 1Z93A 3P5LA 1BNTA 3RYVB 1FR7A 4CACA 3T83A 3M67A 1CALA 3M1QA 3MMFA 2QP6A 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1CA2A 3MNHA 1I9PA 1JCZA 1KWQA 3UYQA 3P44A 1TG3A 3RJ7A 2NNGA 1CNXA 3SBIA 3TMJA 3DD0A 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 3RYZA 3T82A 2H15A 1CAKA 2NN7A 3P58A 3RZ8A 3B1BA 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3DBUA 2NXSA 3NI5A 2HL4A 3U47A 3OYSA 1BNQA 3D92A 1CNJA 3MZCA 3VBDA 3DD8A 2OSFA 4E3HA 1FSRA 1ZGEA 3T85A 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 3OIKA 3M2ZA 3S75B 1DMXA 1KEQA 3JXGA 1V9EA 3D93A 1JD0A 6CA2A 3S8XA 3DAZA 1TTMA
chains in the KnotProt database with same CATH superfamily
1Z9YA 2X7SA 3N3JA 1CCUA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 1ZGFA 3T84A 3DVCA 2CBAA 2X7TA 1CAIA 3V3JA 3TVOX 3MHOA 3RG3A 1RAYA 1BN3A 1OQ5A 1AM6A 1I9NA 1RZDA 3S9TA 1H9QA 3S76A 4FL7A 1MUAA 3KOIA 1DMYA 1FQRA 1FR4A 3S73B 1BNWA 3P55A 1KOQA 1XEGA 9CA2A 3PJJA 4E3FA 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 3NB5A 3RZ5A 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 3QYKA 2F14A 3M2XA 4G0CA 2NNVA 1I9MA 3M5EA 2Q1QA 4E49A 1BNVA 1BZMA 2FOYA 3MNUA 3N0NA 3K34A 3CZVA 2AX2A 1UGCA 1XPZA 3V3HB 1OKLA 3DC3A 3HS4A 3MNAA 1UGDA 3U45X 3CA2A 2NWPA 2HD6A 3ML2A 1BN1A 3RZ1B 1HCAA 3OKUA 3KONA 3P3JA 4E3DA 3JXHC 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3K7KA 3HKQA 1A42A 1ZH9A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 2QOAA 1UGBA 1CNBA 1H9NA 3IBLA 3RYYA 2CA2A 1IF4A 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 3OYQA 1Y7WA 3F8EA 1J9WA 3S71B 3KIGA 3M3XA 3LXEA 4BCWA 3RZ0B 3SAPA 3V3IB 1UGAA 1CNCA 2IT4A 3RG4A 2CBEA 1CAZA 1IF5A 3S78B 3DA2A 1YDDA 12CAA 2HKKA 1G46A 1ZFKA 3PYKA 1ZSBA 2WEGA 3S74B 3CYUA 4FIKA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3V5GA 3OIMA 1HUGA 3EFTA 1G54A 3FFPX 3W6IA 2CBCA 1TB0X 3HLJA 1CA3A 8CA2A 1XQ0A 3KNEA 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 3SAXA 3V3GB 1CNKA 2O4ZA 3M96A 4E4AA 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 3T5ZA 1TBTX 1LZVA 1ZE8A 3M04A 1ZFQA 2FOVA 2NXRA 3OILA 1HUHA 3U7CA 1G53A 1FQMA 2CBBA 2Q1BA 1MOOA 3K2FA 1UGGA 1CNYA 2NWOA 3MHCA 1YDCA 3RLDA 3RYXB 1CRAA 3MNKA 3IEOA 1IF7A 3U3AX 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 3RGEA 3V2JA 1G4JA 3PO6A 1G6VA 3RYJB 2ABEA 1CVFA 2GEHA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 4ILXA 3DCCA 3T5UA 3P3HA 2WD3A 1BCDA 1CNIA 1T9NA 1FQLA 3M2NA 1BN4A 3S72B 3P5AA 3V2MA 1YO2A 3JXFA 3V7XA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 3OY0A 1LG5A 3SBHA 3UYNA 4E3GA 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 1TEQX 2CABA 2QO8A 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3M14A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 4IDRX 1CANA 2HOCA 1HECA 3FW3A 2H4NA 2POVA 3M40A 1CRMA 3TVNX 1HVAA 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 3V3FA 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1CVBA 3M1KA 1G0FA 3RZ7A 2NNOA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3D9ZA 3S77B 3W6HA 3IBUA 1Z93A 3P5LA 1BNTA 3RYVB 1FR7A 4CACA 3T83A 3M67A 1CALA 3M1QA 3MMFA 2QP6A 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1CA2A 3MNHA 1I9PA 1JCZA 1KWQA 3UYQA 3P44A 1TG3A 3RJ7A 2NNGA 1CNXA 3SBIA 3TMJA 3DD0A 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 3RYZA 3T82A 2H15A 1CAKA 2NN7A 3P58A 3RZ8A 3B1BA 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3DBUA 2NXSA 3NI5A 2HL4A 3U47A 3OYSA 1BNQA 3D92A 1CNJA 3MZCA 3VBDA 3DD8A 2OSFA 4E3HA 1FSRA 1ZGEA 3T85A 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 3OIKA 3M2ZA 3S75B 1DMXA 1KEQA 3JXGA 1V9EA 3D93A 1JD0A 6CA2A 3S8XA 3DAZA 1TTMA
chains in the KnotProt database with same CATH topology
1Z9YA 2X7SA 3N3JA 1CCUA 3F7UA 2FMGA 3BL1A 1HEAA 1FSNA 2FOSA 3KS3A 1ZGFA 3T84A 3DVCA 2CBAA 2X7TA 1CAIA 3V3JA 3TVOX 3MHOA 3RG3A 1RAYA 1BN3A 1OQ5A 1AM6A 1I9NA 1RZDA 3S9TA 1H9QA 3S76A 4FL7A 1MUAA 3KOIA 1DMYA 1FQRA 1FR4A 3S73B 1BNWA 3P55A 1KOQA 1XEGA 9CA2A 3PJJA 4E3FA 1CAOA 1CCTA 3BL0A 1HEBA 1OKMA 3DV7A 3DVBA 3IBNA 1CAHA 3NB5A 3RZ5A 1UGEA 3BETA 3DC9A 1BV3A 3OKVA 3QYKA 2F14A 3M2XA 4G0CA 2NNVA 1I9MA 3M5EA 2Q1QA 4E49A 1BNVA 1BZMA 2FOYA 3MNUA 3N0NA 3K34A 3CZVA 2AX2A 1UGCA 1XPZA 3V3HB 1OKLA 3DC3A 3HS4A 3MNAA 1UGDA 3U45X 3CA2A 2NWPA 2HD6A 3ML2A 1BN1A 3RZ1B 1HCAA 3OKUA 3KONA 3P3JA 4E3DA 3JXHC 3M2YA 1TH9A 1I9LA 2POWA 1LUGA 3IAIA 3K7KA 3HKQA 1A42A 1ZH9A 3ZNCA 1FQNA 2AW1A 3N2PA 1TE3X 2QOAA 1UGBA 1CNBA 1H9NA 3IBLA 3RYYA 2CA2A 1IF4A 1DCBA 2WEOA 2FNNA 1G3ZA 2VVAX 1ZNCA 1G48A 1G45A 1ZSAA 3OYQA 1Y7WA 3F8EA 1J9WA 3S71B 3KIGA 3M3XA 3LXEA 4BCWA 3RZ0B 3SAPA 3V3IB 1UGAA 1CNCA 2IT4A 3RG4A 2CBEA 1CAZA 1IF5A 3S78B 3DA2A 1YDDA 12CAA 2HKKA 1G46A 1ZFKA 3PYKA 1ZSBA 2WEGA 3S74B 3CYUA 4FIKA 3M98A 3HKTA 3MDZA 1AZMA 2HNCA 1G1DA 1CVHA 2POUA 1F2WA 3V5GA 3OIMA 1HUGA 3EFTA 1G54A 3FFPX 3W6IA 2CBCA 1TB0X 3HLJA 1CA3A 8CA2A 1XQ0A 3KNEA 2ILIA 1YDBA 1TG9A 2CBDA 1CAYA 1IF6A 3SAXA 3V3GB 1CNKA 2O4ZA 3M96A 4E4AA 1ZSCA 3KOKA 3IQKA 2NWZA 2EZ7A 3HKUA 1I8ZA 3C7PA 3T5ZA 1TBTX 1LZVA 1ZE8A 3M04A 1ZFQA 2FOVA 2NXRA 3OILA 1HUHA 3U7CA 1G53A 1FQMA 2CBBA 2Q1BA 1MOOA 3K2FA 1UGGA 1CNYA 2NWOA 3MHCA 1YDCA 3RLDA 3RYXB 1CRAA 3MNKA 3IEOA 1IF7A 3U3AX 1HCBA 2WEJA 2FNMA 3MWOA 1CNHA 1BICA 7CA2A 3RGEA 3V2JA 1G4JA 3PO6A 1G6VA 3RYJB 2ABEA 1CVFA 2GEHA 2NNSA 3MYQA 1CNGA 3NJ9A 1CVAA 1G52A 3IBIA 2EU2A 3KWAA 1UGFA 4ILXA 3DCCA 3T5UA 3P3HA 2WD3A 1BCDA 1CNIA 1T9NA 1FQLA 3M2NA 1BN4A 3S72B 3P5AA 3V2MA 1YO2A 3JXFA 3V7XA 3F4XA 3N4BA 3IGPA 2HFXA 3M5TA 4CA2A 1I91A 3OY0A 1LG5A 3SBHA 3UYNA 4E3GA 2EU3A 1EOUA 1RJ6A 3L14A 2W2JA 1YDAA 1TEQX 2CABA 2QO8A 2WEHA 2FNKA 1RZCA 2WD2A 2GD8A 3M14A 3F7BA 1XEVA 1YO1A 1URTA 1CZMA 1LGDA 2NMXA 1THKA 3B4FA 1CVDA 2HFYA 3M5SA 1I90A 4IDRX 1CANA 2HOCA 1HECA 3FW3A 2H4NA 2POVA 3M40A 1CRMA 3TVNX 1HVAA 1G0EA 1RJ5A 3MNJA 2HFWA 1BNNA 3KKXA 3R16A 3FE4A 1RZBA 3EFIA 1CNWA 2NWYA 3DCWA 2VVBX 2Q38A 1TEUX 3V3FA 1YO0A 1JV0A 1BNUA 3DCSA 1FLJA 1CVEA 3P4VA 1V9IC 1CAMA 5CA2A 1KWRA 1H4NA 1HEDA 1AVNA 1CVBA 3M1KA 1G0FA 3RZ7A 2NNOA 1I9QA 5CACA 1BNMA 1Z97A 3GZ0A 1RZAA 1G4OA 3D9ZA 3S77B 3W6HA 3IBUA 1Z93A 3P5LA 1BNTA 3RYVB 1FR7A 4CACA 3T83A 3M67A 1CALA 3M1QA 3MMFA 2QP6A 3MHLA 1OKNA 2FW4A 1CINA 1IF8A 3M1JA 2NN1A 1CA2A 3MNHA 1I9PA 1JCZA 1KWQA 3UYQA 3P44A 1TG3A 3RJ7A 2NNGA 1CNXA 3SBIA 3TMJA 3DD0A 1LG6A 3D0NA 3ML5A 3D8WA 1CVCA 3CAJA 1FSQA 2FOQA 3RYZA 3T82A 2H15A 1CAKA 2NN7A 3P58A 3RZ8A 3B1BA 2FMZA 3MHMA 3HFPA 1CIMA 1IF9A 3MNIA 2NXTA 3R17B 3MHIA 3DBUA 2NXSA 3NI5A 2HL4A 3U47A 3OYSA 1BNQA 3D92A 1CNJA 3MZCA 3VBDA 3DD8A 2OSFA 4E3HA 1FSRA 1ZGEA 3T85A 3DVDA 2X7UA 1CAJA 3M1WA 3HKNA 2ZNCA 1CCSA 2OSMA 1RAZA 1CILA 2FOUA 1DCAA 1I9OA 1RZEA 3OIKA 3M2ZA 3S75B 1DMXA 1KEQA 3JXGA 1V9EA 3D93A 1JD0A 6CA2A 3S8XA 3DAZA 1TTMA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1Z9Y A;  2X7S A;  3N3J A;  1CCU A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  1ZGF A;  3T84 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3V3J A;  3TVO X;  3MHO A;  3RG3 A;  1RAY A;  1BN3 A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  3S9T A;  1H9Q A;  3S76 A;  4FL7 A;  1MUA A;  3KOI A;  1DMY A;  1FQR A;  1FR4 A;  3S73 B;  1BNW A;  3P55 A;  1KOQ A;  1XEG A;  9CA2 A;  3PJJ A;  4E3F A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  3NB5 A;  3RZ5 A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  3QYK A;  2F14 A;  3M2X A;  4G0C A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  4E49 A;  1BNV A;  1BZM A;  2FOY A;  3MNU A;  3N0N A;  3K34 A;  3CZV A;  2AX2 A;  1UGC A;  1XPZ A;  3V3H B;  1OKL A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  3U45 X;  3CA2 A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  3RZ1 B;  1HCA A;  3OKU A;  3KON A;  3P3J A;  4E3D A;  3JXH C;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3K7K A;  3HKQ A;  1A42 A;  1ZH9 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  2QOA A;  1UGB A;  1CNB A;  1H9N A;  3IBL A;  3RYY A;  2CA2 A;  1IF4 A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  3OYQ A;  1Y7W A;  3F8E A;  1J9W A;  3S71 B;  3KIG A;  3M3X A;  3LXE A;  4BCW A;  3RZ0 B;  3SAP A;  3V3I B;  1UGA A;  1CNC A;  2IT4 A;  3RG4 A;  2CBE A;  1CAZ A;  1IF5 A;  3S78 B;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1ZFK A;  3PYK A;  1ZSB A;  2WEG A;  3S74 B;  3CYU A;  4FIK A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3V5G A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  3FFP X;  3W6I A;  2CBC A;  1TB0 X;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  3KNE A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  3SAX A;  3V3G B;  1CNK A;  2O4Z A;  3M96 A;  4E4A A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  3T5Z A;  1TBT X;  1LZV A;  1ZE8 A;  3M04 A;  1ZFQ A;  2FOV A;  2NXR A;  3OIL A;  1HUH A;  3U7C A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  1MOO A;  3K2F A;  1UGG A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  3RLD A;  3RYX B;  1CRA A;  3MNK A;  3IEO A;  1IF7 A;  3U3A X;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  3RGE A;  3V2J A;  1G4J A;  3PO6 A;  1G6V A;  3RYJ B;  2ABE A;  1CVF A;  2GEH A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  4ILX A;  3DCC A;  3T5U A;  3P3H A;  2WD3 A;  1BCD A;  1CNI A;  1T9N A;  1FQL A;  3M2N A;  1BN4 A;  3S72 B;  3P5A A;  3V2M A;  1YO2 A;  3JXF A;  3V7X A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  3OY0 A;  1LG5 A;  3SBH A;  3UYN A;  4E3G A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  1TEQ X;  2CAB A;  2QO8 A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3M14 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  4IDR X;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  2H4N A;  2POV A;  3M40 A;  1CRM A;  3TVN X;  1HVA A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  3V3F A;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1CVB A;  3M1K A;  1G0F A;  3RZ7 A;  2NNO A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3D9Z A;  3S77 B;  3W6H A;  3IBU A;  1Z93 A;  3P5L A;  1BNT A;  3RYV B;  1FR7 A;  4CAC A;  3T83 A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  2QP6 A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1CA2 A;  3MNH A;  1I9P A;  1JCZ A;  1KWQ A;  3UYQ A;  3P44 A;  1TG3 A;  3RJ7 A;  2NNG A;  1CNX A;  3SBI A;  3TMJ A;  3DD0 A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  3RYZ A;  3T82 A;  2H15 A;  1CAK A;  2NN7 A;  3P58 A;  3RZ8 A;  3B1B A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3DBU A;  2NXS A;  3NI5 A;  2HL4 A;  3U47 A;  3OYS A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3VBD A;  3DD8 A;  2OSF A;  4E3H A;  1FSR A;  1ZGE A;  3T85 A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  3OIK A;  3M2Z A;  3S75 B;  1DMX A;  1KEQ A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  6CA2 A;  3S8X A;  3DAZ A;  1TTM A; 
#chains in the KnotProt database with same CATH topology
 1Z9Y A;  2X7S A;  3N3J A;  1CCU A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  1ZGF A;  3T84 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3V3J A;  3TVO X;  3MHO A;  3RG3 A;  1RAY A;  1BN3 A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  3S9T A;  1H9Q A;  3S76 A;  4FL7 A;  1MUA A;  3KOI A;  1DMY A;  1FQR A;  1FR4 A;  3S73 B;  1BNW A;  3P55 A;  1KOQ A;  1XEG A;  9CA2 A;  3PJJ A;  4E3F A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  3NB5 A;  3RZ5 A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  3QYK A;  2F14 A;  3M2X A;  4G0C A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  4E49 A;  1BNV A;  1BZM A;  2FOY A;  3MNU A;  3N0N A;  3K34 A;  3CZV A;  2AX2 A;  1UGC A;  1XPZ A;  3V3H B;  1OKL A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  3U45 X;  3CA2 A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  3RZ1 B;  1HCA A;  3OKU A;  3KON A;  3P3J A;  4E3D A;  3JXH C;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3K7K A;  3HKQ A;  1A42 A;  1ZH9 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  2QOA A;  1UGB A;  1CNB A;  1H9N A;  3IBL A;  3RYY A;  2CA2 A;  1IF4 A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  3OYQ A;  1Y7W A;  3F8E A;  1J9W A;  3S71 B;  3KIG A;  3M3X A;  3LXE A;  4BCW A;  3RZ0 B;  3SAP A;  3V3I B;  1UGA A;  1CNC A;  2IT4 A;  3RG4 A;  2CBE A;  1CAZ A;  1IF5 A;  3S78 B;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1ZFK A;  3PYK A;  1ZSB A;  2WEG A;  3S74 B;  3CYU A;  4FIK A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3V5G A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  3FFP X;  3W6I A;  2CBC A;  1TB0 X;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  3KNE A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  3SAX A;  3V3G B;  1CNK A;  2O4Z A;  3M96 A;  4E4A A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  3T5Z A;  1TBT X;  1LZV A;  1ZE8 A;  3M04 A;  1ZFQ A;  2FOV A;  2NXR A;  3OIL A;  1HUH A;  3U7C A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  1MOO A;  3K2F A;  1UGG A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  3RLD A;  3RYX B;  1CRA A;  3MNK A;  3IEO A;  1IF7 A;  3U3A X;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  3RGE A;  3V2J A;  1G4J A;  3PO6 A;  1G6V A;  3RYJ B;  2ABE A;  1CVF A;  2GEH A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  4ILX A;  3DCC A;  3T5U A;  3P3H A;  2WD3 A;  1BCD A;  1CNI A;  1T9N A;  1FQL A;  3M2N A;  1BN4 A;  3S72 B;  3P5A A;  3V2M A;  1YO2 A;  3JXF A;  3V7X A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  3OY0 A;  1LG5 A;  3SBH A;  3UYN A;  4E3G A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  1TEQ X;  2CAB A;  2QO8 A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3M14 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  4IDR X;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  2H4N A;  2POV A;  3M40 A;  1CRM A;  3TVN X;  1HVA A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  3V3F A;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1CVB A;  3M1K A;  1G0F A;  3RZ7 A;  2NNO A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3D9Z A;  3S77 B;  3W6H A;  3IBU A;  1Z93 A;  3P5L A;  1BNT A;  3RYV B;  1FR7 A;  4CAC A;  3T83 A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  2QP6 A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1CA2 A;  3MNH A;  1I9P A;  1JCZ A;  1KWQ A;  3UYQ A;  3P44 A;  1TG3 A;  3RJ7 A;  2NNG A;  1CNX A;  3SBI A;  3TMJ A;  3DD0 A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  3RYZ A;  3T82 A;  2H15 A;  1CAK A;  2NN7 A;  3P58 A;  3RZ8 A;  3B1B A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3DBU A;  2NXS A;  3NI5 A;  2HL4 A;  3U47 A;  3OYS A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3VBD A;  3DD8 A;  2OSF A;  4E3H A;  1FSR A;  1ZGE A;  3T85 A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  3OIK A;  3M2Z A;  3S75 B;  1DMX A;  1KEQ A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  6CA2 A;  3S8X A;  3DAZ A;  1TTM A; 
#chains in the KnotProt database with same CATH homology
 1Z9Y A;  2X7S A;  3N3J A;  1CCU A;  3F7U A;  2FMG A;  3BL1 A;  1HEA A;  1FSN A;  2FOS A;  3KS3 A;  1ZGF A;  3T84 A;  3DVC A;  2CBA A;  2X7T A;  1CAI A;  3V3J A;  3TVO X;  3MHO A;  3RG3 A;  1RAY A;  1BN3 A;  1OQ5 A;  1AM6 A;  1I9N A;  1RZD A;  3S9T A;  1H9Q A;  3S76 A;  4FL7 A;  1MUA A;  3KOI A;  1DMY A;  1FQR A;  1FR4 A;  3S73 B;  1BNW A;  3P55 A;  1KOQ A;  1XEG A;  9CA2 A;  3PJJ A;  4E3F A;  1CAO A;  1CCT A;  3BL0 A;  1HEB A;  1OKM A;  3DV7 A;  3DVB A;  3IBN A;  1CAH A;  3NB5 A;  3RZ5 A;  1UGE A;  3BET A;  3DC9 A;  1BV3 A;  3OKV A;  3QYK A;  2F14 A;  3M2X A;  4G0C A;  2NNV A;  1I9M A;  3M5E A;  2Q1Q A;  4E49 A;  1BNV A;  1BZM A;  2FOY A;  3MNU A;  3N0N A;  3K34 A;  3CZV A;  2AX2 A;  1UGC A;  1XPZ A;  3V3H B;  1OKL A;  3DC3 A;  3HS4 A;  3MNA A;  1UGD A;  3U45 X;  3CA2 A;  2NWP A;  2HD6 A;  3ML2 A;  1BN1 A;  3RZ1 B;  1HCA A;  3OKU A;  3KON A;  3P3J A;  4E3D A;  3JXH C;  3M2Y A;  1TH9 A;  1I9L A;  2POW A;  1LUG A;  3IAI A;  3K7K A;  3HKQ A;  1A42 A;  1ZH9 A;  3ZNC A;  1FQN A;  2AW1 A;  3N2P A;  1TE3 X;  2QOA A;  1UGB A;  1CNB A;  1H9N A;  3IBL A;  3RYY A;  2CA2 A;  1IF4 A;  1DCB A;  2WEO A;  2FNN A;  1G3Z A;  2VVA X;  1ZNC A;  1G48 A;  1G45 A;  1ZSA A;  3OYQ A;  1Y7W A;  3F8E A;  1J9W A;  3S71 B;  3KIG A;  3M3X A;  3LXE A;  4BCW A;  3RZ0 B;  3SAP A;  3V3I B;  1UGA A;  1CNC A;  2IT4 A;  3RG4 A;  2CBE A;  1CAZ A;  1IF5 A;  3S78 B;  3DA2 A;  1YDD A;  12CA A;  2HKK A;  1G46 A;  1ZFK A;  3PYK A;  1ZSB A;  2WEG A;  3S74 B;  3CYU A;  4FIK A;  3M98 A;  3HKT A;  3MDZ A;  1AZM A;  2HNC A;  1G1D A;  1CVH A;  2POU A;  1F2W A;  3V5G A;  3OIM A;  1HUG A;  3EFT A;  1G54 A;  3FFP X;  3W6I A;  2CBC A;  1TB0 X;  3HLJ A;  1CA3 A;  8CA2 A;  1XQ0 A;  3KNE A;  2ILI A;  1YDB A;  1TG9 A;  2CBD A;  1CAY A;  1IF6 A;  3SAX A;  3V3G B;  1CNK A;  2O4Z A;  3M96 A;  4E4A A;  1ZSC A;  3KOK A;  3IQK A;  2NWZ A;  2EZ7 A;  3HKU A;  1I8Z A;  3C7P A;  3T5Z A;  1TBT X;  1LZV A;  1ZE8 A;  3M04 A;  1ZFQ A;  2FOV A;  2NXR A;  3OIL A;  1HUH A;  3U7C A;  1G53 A;  1FQM A;  2CBB A;  2Q1B A;  1MOO A;  3K2F A;  1UGG A;  1CNY A;  2NWO A;  3MHC A;  1YDC A;  3RLD A;  3RYX B;  1CRA A;  3MNK A;  3IEO A;  1IF7 A;  3U3A X;  1HCB A;  2WEJ A;  2FNM A;  3MWO A;  1CNH A;  1BIC A;  7CA2 A;  3RGE A;  3V2J A;  1G4J A;  3PO6 A;  1G6V A;  3RYJ B;  2ABE A;  1CVF A;  2GEH A;  2NNS A;  3MYQ A;  1CNG A;  3NJ9 A;  1CVA A;  1G52 A;  3IBI A;  2EU2 A;  3KWA A;  1UGF A;  4ILX A;  3DCC A;  3T5U A;  3P3H A;  2WD3 A;  1BCD A;  1CNI A;  1T9N A;  1FQL A;  3M2N A;  1BN4 A;  3S72 B;  3P5A A;  3V2M A;  1YO2 A;  3JXF A;  3V7X A;  3F4X A;  3N4B A;  3IGP A;  2HFX A;  3M5T A;  4CA2 A;  1I91 A;  3OY0 A;  1LG5 A;  3SBH A;  3UYN A;  4E3G A;  2EU3 A;  1EOU A;  1RJ6 A;  3L14 A;  2W2J A;  1YDA A;  1TEQ X;  2CAB A;  2QO8 A;  2WEH A;  2FNK A;  1RZC A;  2WD2 A;  2GD8 A;  3M14 A;  3F7B A;  1XEV A;  1YO1 A;  1URT A;  1CZM A;  1LGD A;  2NMX A;  1THK A;  3B4F A;  1CVD A;  2HFY A;  3M5S A;  1I90 A;  4IDR X;  1CAN A;  2HOC A;  1HEC A;  3FW3 A;  2H4N A;  2POV A;  3M40 A;  1CRM A;  3TVN X;  1HVA A;  1G0E A;  1RJ5 A;  3MNJ A;  2HFW A;  1BNN A;  3KKX A;  3R16 A;  3FE4 A;  1RZB A;  3EFI A;  1CNW A;  2NWY A;  3DCW A;  2VVB X;  2Q38 A;  1TEU X;  3V3F A;  1YO0 A;  1JV0 A;  1BNU A;  3DCS A;  1FLJ A;  1CVE A;  3P4V A;  1V9I C;  1CAM A;  5CA2 A;  1KWR A;  1H4N A;  1HED A;  1AVN A;  1CVB A;  3M1K A;  1G0F A;  3RZ7 A;  2NNO A;  1I9Q A;  5CAC A;  1BNM A;  1Z97 A;  3GZ0 A;  1RZA A;  1G4O A;  3D9Z A;  3S77 B;  3W6H A;  3IBU A;  1Z93 A;  3P5L A;  1BNT A;  3RYV B;  1FR7 A;  4CAC A;  3T83 A;  3M67 A;  1CAL A;  3M1Q A;  3MMF A;  2QP6 A;  3MHL A;  1OKN A;  2FW4 A;  1CIN A;  1IF8 A;  3M1J A;  2NN1 A;  1CA2 A;  3MNH A;  1I9P A;  1JCZ A;  1KWQ A;  3UYQ A;  3P44 A;  1TG3 A;  3RJ7 A;  2NNG A;  1CNX A;  3SBI A;  3TMJ A;  3DD0 A;  1LG6 A;  3D0N A;  3ML5 A;  3D8W A;  1CVC A;  3CAJ A;  1FSQ A;  2FOQ A;  3RYZ A;  3T82 A;  2H15 A;  1CAK A;  2NN7 A;  3P58 A;  3RZ8 A;  3B1B A;  2FMZ A;  3MHM A;  3HFP A;  1CIM A;  1IF9 A;  3MNI A;  2NXT A;  3R17 B;  3MHI A;  3DBU A;  2NXS A;  3NI5 A;  2HL4 A;  3U47 A;  3OYS A;  1BNQ A;  3D92 A;  1CNJ A;  3MZC A;  3VBD A;  3DD8 A;  2OSF A;  4E3H A;  1FSR A;  1ZGE A;  3T85 A;  3DVD A;  2X7U A;  1CAJ A;  3M1W A;  3HKN A;  2ZNC A;  1CCS A;  2OSM A;  1RAZ A;  1CIL A;  2FOU A;  1DCA A;  1I9O A;  1RZE A;  3OIK A;  3M2Z A;  3S75 B;  1DMX A;  1KEQ A;  3JXG A;  1V9E A;  3D93 A;  1JD0 A;  6CA2 A;  3S8X A;  3DAZ A;  1TTM A; 
3KS3A 3K34A 3U7CA 1LUGA 4FRCA 4FU5A 4MTYA 4FPTA 2FOUA 2NNOA 3V7XA 2NNSA 2ILIA 4Q78A 3VBDA 5LJQA 4FVNA 4FVOA 3D92A 4PZHA 3D93A 4Q08A 4WL4A 3HS4A 1MOOA 5JGTB 2FOSA 5JGSB 3SAXA 2NNVA 4Q6DA 4Q6EA 5JEHB 5EKJA 5JE7B 2WEGA 4Q07A 3RYYA 2EU2A 4Q06A 3M2YA 2FOVA 5SZ6A 4RUXA 4ITOA 5JG5B 4FIKA 5JEPB 4HF3A 2NXTA 5JESB 5JEGB 2NNGA 4CNXA 3RYVB 5BYIA 5CJLA 5JG3B 3MHOA 4Q09A 3L14A 4RUYA 5EHVA 5TXYA 5U0FA 3RJ7A 5EH5A 3GZ0A 5G0CA 4Z1JA 3S71B 3PYKA 5SZ5A 2FOQA 3S8XA 3S9TA 5T71A 5AMLA 4QIYA 3KNEA 3M1KA 4RH2A 5JQTA 4BF1A 5EKMA 5JDVB 5EKHA 5JQ0A 4Z1KA 3MYQA 3M14A 4MDGA 3ZP9A 3M1WA 3KIGA 4HEZA 4KUVA 5E28A 3RYZA 3RYJB 3M04A 5G01A 3M5SA 3SBIA 5EH8A 5BRWA 5EHWA 3OKVA 4QEFA 5EH7A 3OKUA 3MWOA 2WEOA 3S74B 5E2KA 4HEYA 3OIMA 4KNNA 4Z0QA 5TI0A 1OQ5A 4HT2A 3PO6A 3M96A 3RZ1B 4CQ0A 3OIKA 4E49A 3MHMA 2QO8A 3RG4A 4YVYA 3M98A 3DD0A 4YWPA 4Q8YA 4QK3A 3N0NA 5E2MA 4QSBA 3QYKA 3P5AA 3OILA 3P58A 3MNAA 3HLJA 3S75B 3OYQA 4DZ7A 3N3JA 4Q8ZA 3DCWA 3MZCA 5G0BA 4ZWYA 3IBUA 4Q7WA 4KP5A 4ZX1A 4R5BA 3MMFA 4DZ9A 3V2MA 5AMDA 4QY3A 4N16A 4E4AA 4Q99A 4MDLA 3RLDA 3P5LA 2AW1A 2WEJA 4QK2A 2CBAA 5TH4A 2QP6A 4E3FA 4KAPA 4QSAA 4GL1X 5E2SA 1ZFQA 3OYSA 4E3HA 3TVNX 4Z1NA 2GD8A 3P3HA 5A6HA 4JSAA 4KV0A 5CLUA 2VVAX 4Q9YA 4RN4A 5EHEA 4BCWA 4KUWA 3U3AX 4Q90A 3N4BA 4L5VA 3V5GA 4Q8XA 5FNKA 3DCCA 5FNLA 3D0NA 3DAZA 5AMGA 1JD0A 1ZFKA 4MDMA 4ILXA 4Q87A 4Q83A 3DC9A 5FNIA 4JSSA 5E2NA 3R16A 4CNVA 4ZX0A 4IWZA 4M2WA 2AX2A 4K13A 5FNMA 4Q81A 3V3GB 2HL4A 3OY0A 3KONA 4QIZA 3IBLA 3S76A 2WD2A 3M40A 3S72B 4N0XB 5FNHA 3D9ZA 2OSFA 4QJ0A 3RZ8A 5FNJA 4JS6A 2EU3A 5DVXA 4QJWA 4RUZA 4IDRX 3TVOX 3RYXB 3RZ5A 4Q7VA 3DVCA 4ZWZA 4E3DA 3N2PA 5E2RA 4HT0A 4RIUA 4R5AA 4E3GA 2HNCA 1JCZA 4QK1A 1ZGEA 3MNHA 4M2VA 5FLTA 2QOAA 1HCBA 3V2JA 3DC3A 4KUYA 4R59A 4MLXA 4RIVA 2CBDA 3KOKA 3M2NA 3DVDA 1G0EA 1G0FA 5FLRA 2CBBA 4QJPA 3IGPA 3DBUA 4L5WA 4ZWIA 3U47A 3D8WA 2Q1BA 5FLOA 2OSMA 5C8IA 2POVA 5FLPA 1TH9A 4LHIA 3R17B 4ITPA 4Q7PA 4RFDA 3P3JA 2POUA 3M1QA 2VVBX 1ZH9A 5FLQA 3V3JA 2NMXA 1CAMA 3SBHA 3T5ZA 3M3XA 1FR7A 5J8ZA 2FOYA 1Z9YA 2W2JA 5FLSA 5LMDA 4HEWA 3MHIA 3MHCA 3M5EA 4QSJA 2NWYA 3MNKA 3RZ7A 4PYYA 3MNIA 4HBAA 3U45X 3RZ0B 4ZWXA 4E5QA 2F14A 3MNJA 3DCSA 1YO1A 3DV7A 2NWOA 4K1QA 4K0ZA 3C7PA 2NXRA 2NN1A 2FMZA 4K0TA 5EOIA 5N0EA 4QJMA 2FMGA 3M2ZA 3DVBA 1FR4A 2WD3A 4BF6A 1ZGFA 5FDCA 3HKUA 1FLJA 1RZBA 3T5UA 1MUAA 5O07A 3S73B 1CNIA 1RAYA 1CAIA 3T83A 2CBEA 3RG3A 4QJOA 1G52A 3KOIA 4QTLA 1THKA 3SAPA 3HKQA 4XE1A 1YO2A 2POWA 4KNIA 1CNJA 1CANA 4K0SA 1TG3A 4PQ7A 3UYQA 4RFCA 3MNUA 3EFIA 1BICA 1CAOA 4ZAOA 5FDIA 1ZSCA 1RZDA 4FL7A 4MO8A 2NXSA 3V3IB 1RZCA 1RZEA 3CAJA 1RZAA 1CAJA 3M67A 1CAZA 1CRAA 4PYXA 1I9QA 3V3HB 1XEGA 1BCDA 1XQ0A 1TE3X 1CAHA 3M2XA 2HD6A 5A25A 4M2UA 3BETA 1H9NA 1TBTX 2NWPA 1BV3A 1YO0A 3ML2A 1CAKA 1TEQX 1TEUX 2CBCA 2NWZA 1G45A 1LG5A 4Q7SA 5JMZA 3FFPX 3NB5A 3CYUA 1F2WA 1G4JA 3M1JA 1G48A 1YDBA 1G46A 3MHLA 1TG9A 3HKNA 3S77B 5FL4A 4JSZA 1TB0X 1G54A 1G3ZA 2X7SA 2FNNA 1UGEA 1CNXA 4KP8A 4PXXA 2FNKA 4QSIA 5CJFA 1CNGA 2CA2A 1I9MA 2H4NA 3IBIA 1I91A 1YDCA 2FNMA 3T82A 1KEQA 1AVNA 1H4NA 1UGAA 3EFTA 1IF9A 1RAZA 4KNMA 5FL6A 1I90A 5EIJA 1AM6A 3T84A 2HKKA 2H15A 1UGCA 4HU1A 1LGDA 3M5TA 2NN7A 1ZSBA 3P4VA 1CAYA 3RGEA 3PJJA 1TTMA 4L5UA 3B4FA 1CNHA 3S78B 3K7KA 4KNJA 1HUGA 2Q38A 5FL5A 4M2RA 3LXEA 1UGFA 1CA2A 2Q1QA 1CNWA 1I9OA 3DA2A 1UGBA 3BL0A 3F4XA 4MLTA 1UGDA 1CRMA 4Z1EA 3CZVA 3ML5A 5GMMA 1FQLA 1HEBA 4LU3A 3DD8A 2X7TA 2ABEA 1HEAA 1HECA 4QJXA 1G53A 1I9NA 5CA2A 1FQMA 1BZMA 1CZMA 1HEDA 1G4OA 1BN4A 3P55A 1FQNA 1BN1A 2WEHA 5FNGA 1BNUA 3V3FA 3CA2A 2CABA 1T9NA 1AZMA 1I9PA 4JSWA 1JV0A 1EOUA 1BNTA 1BNWA 1IF4A 3F8EA 3NJ9A 3IAIA 4CA2A 1IF8A 1YDAA 1I9LA 1I8ZA 1DCBA 1XPZA 2GEHA 1OKMA 1G1DA 2HOCA 1OKLA 1IF7A 1Z97A 1YDDA 1CNKA 1HUHA 1CALA 3K2FA 1BN3A 1FQRA 1FSQA 2FW4A 1HVAA 1ZE8A 1IF5A 1BNVA 1CCTA 4CNWA 1UGGA 1CNCA 1BNNA 2X7UA 1BNQA 5BNLA 1H9QA 1DCAA 3P44A 1CVAA 1Z93A 4LP6A 1HCAA 1CVDA 3HFPA 1CVFA 3IBNA 4CACA 1IF6A 1CA3A 1CCUA 2O4ZA 5CACA 1CVCA 3HKTA 3KWAA 1OKNA 1CVEA 1FSRA 1FSNA 3T85A 1CNYA 1LG6A 1CVHA 2IT4A 1KWRA 1LZVA 3BL1A 1BNMA 1CCSA 12CAA 7CA2A 8CA2A 3NI5A 1XEVA 1CNBA 3IEOA 1V9EA 1CVBA 1DMXA 1DMYA 4CNRA 1ZSAA 4Q0LA 3MDZA 3TMJA 1URTA 6CA2A 2EZ7A 2HFWA 1KWQA 1J9WA 3UYNA 9CA2A 3W6IA 1RJ6A 1RJ5A 3W6HA 5L9EA 1V9IC 1G6VA 4Y0JA 4Q49A 4G0CA 3KKXA 1A42A 1CILA 1CIMA 1CINA 4WW6A 5U0EA 5VGYA 5TY8A 5TYAA 4WW8A 5TY9A 5U0GA 5U0DA 5JN1A 4WR7A 4WUQA 4WUPA
similar chains in the KnotProt database (40% sequence similarity)
4YXIA 5LJTA 5LL8A 4YX4A 5DOHA 5DOHB 4YXOA 4YYTA 4YGJA 4YXUA 5LLCA 5DRSA 5LL4A 5LL4B 5LLGA 5DSIA 5DSJA 5T74A 5DSKA 5DSMA 5DSRA 4YGNA 5T72A 4QIYB 4QIYC 4QIYD 5G03A 5DSOA 5DSPA 5DSLA 5DSNA 5THNA 5DSQA 5LVSA 5LVSB 3MWOB 4KNNB 5LL5A 5LL5B 5LL5C 5LL5D 4HT2B 4HT2C 4HT2D 4WW8B 4WW8C 4WW8D 5E2MB 5T75A 5LL9A 5LL9B 5LL9C 5LL9D 5THJA 5LLPA 5LLPB 5LLPC 5LLPD 4KP5B 4KP5C 4KP5D 5THIA 5JN7A 4YGKA 5SZ1A 5BRUA 5LLAA 5LLAB 5TFXA 3D0NB 1JD0B 5E2NB 4YGLA 4WR7B 4QIZB 5SZ2A 4QJ0B 4QJ0C 4QJ0D 5DVXB 4QJWB 4QJWC 4QJWD 5JN3A 5LLNA 5LLNB 1JCZB 5SZ0A 4QJPB 5SZ4A 5EZTX 5BRVA 5LLOA 5LLOB 5LLOC 5LLOD 5L6KA 5L6KB 2NMXB 5SZ3A 1FR7B 2FOYB 5DOGA 4QSJB 5N0DA 2NN1B 5SZ7A 5GMNA 4WUQB 4QJOB 4QJOC 4QJOD 4WUPB 5A25B 5LLEA 5FL4B 5FL4C 5FL4D 4KP8B 4KP8C 4KP8D 1KEQB 4KNMB 5FL6B 5FL6C 5FL6D 5LLHA 4HU1B 2NN7B 5FL5B 5FL5C 5FL5D 3LXEB 3DA2B 3CZVB 5GMMB 1JV0B 3IAIB 3IAIC 3IAID 5L3OA 5L3OB 1FSQB 2FW4B 5L70A 5L70B 4CNWB 4LP6B 1FSRB 1FSNB 2IT4B 1XEVB 1XEVC 1XEVD 1V9EB 1DMXB 1DMYB 4CNRB 4CNRC 4CNRD 4Q0LB 4Q0LC 4Q0LD 1J9WB 5L6TA 5L6TB 3W6IE 1RJ6B 1RJ5B 3W6HB 5L9EB 5L9EC 5L9ED
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3KS3 A;  3K34 A;  3U7C A;  1LUG A;  4FRC A;  4FU5 A;  4MTY A;  4FPT A;  2FOU A;  2NNO A;  3V7X A;  2NNS A;  2ILI A;  4Q78 A;  3VBD A;  5LJQ A;  4FVN A;  4FVO A;  3D92 A;  4PZH A;  3D93 A;  4Q08 A;  4WL4 A;  3HS4 A;  1MOO A;  5JGT B;  2FOS A;  5JGS B;  3SAX A;  2NNV A;  4Q6D A;  4Q6E A;  5JEH B;  5EKJ A;  5JE7 B;  2WEG A;  4Q07 A;  3RYY A;  2EU2 A;  4Q06 A;  3M2Y A;  2FOV A;  5SZ6 A;  4RUX A;  4ITO A;  5JG5 B;  4FIK A;  5JEP B;  4HF3 A;  2NXT A;  5JES B;  5JEG B;  2NNG A;  4CNX A;  3RYV B;  5BYI A;  5CJL A;  5JG3 B;  3MHO A;  4Q09 A;  3L14 A;  4RUY A;  5EHV A;  5TXY A;  5U0F A;  3RJ7 A;  5EH5 A;  3GZ0 A;  5G0C A;  4Z1J A;  3S71 B;  3PYK A;  5SZ5 A;  2FOQ A;  3S8X A;  3S9T A;  5T71 A;  5AML A;  4QIY A;  3KNE A;  3M1K A;  4RH2 A;  5JQT A;  4BF1 A;  5EKM A;  5JDV B;  5EKH A;  5JQ0 A;  4Z1K A;  3MYQ A;  3M14 A;  4MDG A;  3ZP9 A;  3M1W A;  3KIG A;  4HEZ A;  4KUV A;  5E28 A;  3RYZ A;  3RYJ B;  3M04 A;  5G01 A;  3M5S A;  3SBI A;  5EH8 A;  5BRW A;  5EHW A;  3OKV A;  4QEF A;  5EH7 A;  3OKU A;  3MWO A;  2WEO A;  3S74 B;  5E2K A;  4HEY A;  3OIM A;  4KNN A;  4Z0Q A;  5TI0 A;  1OQ5 A;  4HT2 A;  3PO6 A;  3M96 A;  3RZ1 B;  4CQ0 A;  3OIK A;  4E49 A;  3MHM A;  2QO8 A;  3RG4 A;  4YVY A;  3M98 A;  3DD0 A;  4YWP A;  4Q8Y A;  4QK3 A;  3N0N A;  5E2M A;  4QSB A;  3QYK A;  3P5A A;  3OIL A;  3P58 A;  3MNA A;  3HLJ A;  3S75 B;  3OYQ A;  4DZ7 A;  3N3J A;  4Q8Z A;  3DCW A;  3MZC A;  5G0B A;  4ZWY A;  3IBU A;  4Q7W A;  4KP5 A;  4ZX1 A;  4R5B A;  3MMF A;  4DZ9 A;  3V2M A;  5AMD A;  4QY3 A;  4N16 A;  4E4A A;  4Q99 A;  4MDL A;  3RLD A;  3P5L A;  2AW1 A;  2WEJ A;  4QK2 A;  2CBA A;  5TH4 A;  2QP6 A;  4E3F A;  4KAP A;  4QSA A;  4GL1 X;  5E2S A;  1ZFQ A;  3OYS A;  4E3H A;  3TVN X;  4Z1N A;  2GD8 A;  3P3H A;  5A6H A;  4JSA A;  4KV0 A;  5CLU A;  2VVA X;  4Q9Y A;  4RN4 A;  5EHE A;  4BCW A;  4KUW A;  3U3A X;  4Q90 A;  3N4B A;  4L5V A;  3V5G A;  4Q8X A;  5FNK A;  3DCC A;  5FNL A;  3D0N A;  3DAZ A;  5AMG A;  1JD0 A;  1ZFK A;  4MDM A;  4ILX A;  4Q87 A;  4Q83 A;  3DC9 A;  5FNI A;  4JSS A;  5E2N A;  3R16 A;  4CNV A;  4ZX0 A;  4IWZ A;  4M2W A;  2AX2 A;  4K13 A;  5FNM A;  4Q81 A;  3V3G B;  2HL4 A;  3OY0 A;  3KON A;  4QIZ A;  3IBL A;  3S76 A;  2WD2 A;  3M40 A;  3S72 B;  4N0X B;  5FNH A;  3D9Z A;  2OSF A;  4QJ0 A;  3RZ8 A;  5FNJ A;  4JS6 A;  2EU3 A;  5DVX A;  4QJW A;  4RUZ A;  4IDR X;  3TVO X;  3RYX B;  3RZ5 A;  4Q7V A;  3DVC A;  4ZWZ A;  4E3D A;  3N2P A;  5E2R A;  4HT0 A;  4RIU A;  4R5A A;  4E3G A;  2HNC A;  1JCZ A;  4QK1 A;  1ZGE A;  3MNH A;  4M2V A;  5FLT A;  2QOA A;  1HCB A;  3V2J A;  3DC3 A;  4KUY A;  4R59 A;  4MLX A;  4RIV A;  2CBD A;  3KOK A;  3M2N A;  3DVD A;  1G0E A;  1G0F A;  5FLR A;  2CBB A;  4QJP A;  3IGP A;  3DBU A;  4L5W A;  4ZWI A;  3U47 A;  3D8W A;  2Q1B A;  5FLO A;  2OSM A;  5C8I A;  2POV A;  5FLP A;  1TH9 A;  4LHI A;  3R17 B;  4ITP A;  4Q7P A;  4RFD A;  3P3J A;  2POU A;  3M1Q A;  2VVB X;  1ZH9 A;  5FLQ A;  3V3J A;  2NMX A;  1CAM A;  3SBH A;  3T5Z A;  3M3X A;  1FR7 A;  5J8Z A;  2FOY A;  1Z9Y A;  2W2J A;  5FLS A;  5LMD A;  4HEW A;  3MHI A;  3MHC A;  3M5E A;  4QSJ A;  2NWY A;  3MNK A;  3RZ7 A;  4PYY A;  3MNI A;  4HBA A;  3U45 X;  3RZ0 B;  4ZWX A;  4E5Q A;  2F14 A;  3MNJ A;  3DCS A;  1YO1 A;  3DV7 A;  2NWO A;  4K1Q A;  4K0Z A;  3C7P A;  2NXR A;  2NN1 A;  2FMZ A;  4K0T A;  5EOI A;  5N0E A;  4QJM A;  2FMG A;  3M2Z A;  3DVB A;  1FR4 A;  2WD3 A;  4BF6 A;  1ZGF A;  5FDC A;  3HKU A;  1FLJ A;  1RZB A;  3T5U A;  1MUA A;  5O07 A;  3S73 B;  1CNI A;  1RAY A;  1CAI A;  3T83 A;  2CBE A;  3RG3 A;  4QJO A;  1G52 A;  3KOI A;  4QTL A;  1THK A;  3SAP A;  3HKQ A;  4XE1 A;  1YO2 A;  2POW A;  4KNI A;  1CNJ A;  1CAN A;  4K0S A;  1TG3 A;  4PQ7 A;  3UYQ A;  4RFC A;  3MNU A;  3EFI A;  1BIC A;  1CAO A;  4ZAO A;  5FDI A;  1ZSC A;  1RZD A;  4FL7 A;  4MO8 A;  2NXS A;  3V3I B;  1RZC A;  1RZE A;  3CAJ A;  1RZA A;  1CAJ A;  3M67 A;  1CAZ A;  1CRA A;  4PYX A;  1I9Q A;  3V3H B;  1XEG A;  1BCD A;  1XQ0 A;  1TE3 X;  1CAH A;  3M2X A;  2HD6 A;  5A25 A;  4M2U A;  3BET A;  1H9N A;  1TBT X;  2NWP A;  1BV3 A;  1YO0 A;  3ML2 A;  1CAK A;  1TEQ X;  1TEU X;  2CBC A;  2NWZ A;  1G45 A;  1LG5 A;  4Q7S A;  5JMZ A;  3FFP X;  3NB5 A;  3CYU A;  1F2W A;  1G4J A;  3M1J A;  1G48 A;  1YDB A;  1G46 A;  3MHL A;  1TG9 A;  3HKN A;  3S77 B;  5FL4 A;  4JSZ A;  1TB0 X;  1G54 A;  1G3Z A;  2X7S A;  2FNN A;  1UGE A;  1CNX A;  4KP8 A;  4PXX A;  2FNK A;  4QSI A;  5CJF A;  1CNG A;  2CA2 A;  1I9M A;  2H4N A;  3IBI A;  1I91 A;  1YDC A;  2FNM A;  3T82 A;  1KEQ A;  1AVN A;  1H4N A;  1UGA A;  3EFT A;  1IF9 A;  1RAZ A;  4KNM A;  5FL6 A;  1I90 A;  5EIJ A;  1AM6 A;  3T84 A;  2HKK A;  2H15 A;  1UGC A;  4HU1 A;  1LGD A;  3M5T A;  2NN7 A;  1ZSB A;  3P4V A;  1CAY A;  3RGE A;  3PJJ A;  1TTM A;  4L5U A;  3B4F A;  1CNH A;  3S78 B;  3K7K A;  4KNJ A;  1HUG A;  2Q38 A;  5FL5 A;  4M2R A;  3LXE A;  1UGF A;  1CA2 A;  2Q1Q A;  1CNW A;  1I9O A;  3DA2 A;  1UGB A;  3BL0 A;  3F4X A;  4MLT A;  1UGD A;  1CRM A;  4Z1E A;  3CZV A;  3ML5 A;  5GMM A;  1FQL A;  1HEB A;  4LU3 A;  3DD8 A;  2X7T A;  2ABE A;  1HEA A;  1HEC A;  4QJX A;  1G53 A;  1I9N A;  5CA2 A;  1FQM A;  1BZM A;  1CZM A;  1HED A;  1G4O A;  1BN4 A;  3P55 A;  1FQN A;  1BN1 A;  2WEH A;  5FNG A;  1BNU A;  3V3F A;  3CA2 A;  2CAB A;  1T9N A;  1AZM A;  1I9P A;  4JSW A;  1JV0 A;  1EOU A;  1BNT A;  1BNW A;  1IF4 A;  3F8E A;  3NJ9 A;  3IAI A;  4CA2 A;  1IF8 A;  1YDA A;  1I9L A;  1I8Z A;  1DCB A;  1XPZ A;  2GEH A;  1OKM A;  1G1D A;  2HOC A;  1OKL A;  1IF7 A;  1Z97 A;  1YDD A;  1CNK A;  1HUH A;  1CAL A;  3K2F A;  1BN3 A;  1FQR A;  1FSQ A;  2FW4 A;  1HVA A;  1ZE8 A;  1IF5 A;  1BNV A;  1CCT A;  4CNW A;  1UGG A;  1CNC A;  1BNN A;  2X7U A;  1BNQ A;  5BNL A;  1H9Q A;  1DCA A;  3P44 A;  1CVA A;  1Z93 A;  4LP6 A;  1HCA A;  1CVD A;  3HFP A;  1CVF A;  3IBN A;  4CAC A;  1IF6 A;  1CA3 A;  1CCU A;  2O4Z A;  5CAC A;  1CVC A;  3HKT A;  3KWA A;  1OKN A;  1CVE A;  1FSR A;  1FSN A;  3T85 A;  1CNY A;  1LG6 A;  1CVH A;  2IT4 A;  1KWR A;  1LZV A;  3BL1 A;  1BNM A;  1CCS A;  12CA A;  7CA2 A;  8CA2 A;  3NI5 A;  1XEV A;  1CNB A;  3IEO A;  1V9E A;  1CVB A;  1DMX A;  1DMY A;  4CNR A;  1ZSA A;  4Q0L A;  3MDZ A;  3TMJ A;  1URT A;  6CA2 A;  2EZ7 A;  2HFW A;  1KWQ A;  1J9W A;  3UYN A;  9CA2 A;  3W6I A;  1RJ6 A;  1RJ5 A;  3W6H A;  5L9E A;  1V9I C;  1G6V A;  4Y0J A;  4Q49 A;  4G0C A;  3KKX A;  1A42 A;  1CIL A;  1CIM A;  1CIN A; 
               
               
#similar chains, but unknotted
 4WW6 A;  5U0E A;  5VGY A;  5TY8 A;  5TYA A;  4WW8 A;  5TY9 A;  5U0G A;  5U0D A;  5JN1 A;  4WR7 A;  4WUQ A;  4WUP A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 4YXI A;  5LJT A;  5LL8 A;  4YX4 A;  5DOH A;  5DOH B;  4YXO A;  4YYT A;  4YGJ A;  4YXU A;  5LLC A;  5DRS A;  5LL4 A;  5LL4 B;  5LLG A;  5DSI A;  5DSJ A;  5T74 A;  5DSK A;  5DSM A;  5DSR A;  4YGN A;  5T72 A;  4QIY B;  4QIY C;  4QIY D;  5G03 A;  5DSO A;  5DSP A;  5DSL A;  5DSN A;  5THN A;  5DSQ A;  5LVS A;  5LVS B;  3MWO B;  4KNN B;  5LL5 A;  5LL5 B;  5LL5 C;  5LL5 D;  4HT2 B;  4HT2 C;  4HT2 D;  4WW8 B;  4WW8 C;  4WW8 D;  5E2M B;  5T75 A;  5LL9 A;  5LL9 B;  5LL9 C;  5LL9 D;  5THJ A;  5LLP A;  5LLP B;  5LLP C;  5LLP D;  4KP5 B;  4KP5 C;  4KP5 D;  5THI A;  5JN7 A;  4YGK A;  5SZ1 A;  5BRU A;  5LLA A;  5LLA B;  5TFX A;  3D0N B;  1JD0 B;  5E2N B;  4YGL A;  4WR7 B;  4QIZ B;  5SZ2 A;  4QJ0 B;  4QJ0 C;  4QJ0 D;  5DVX B;  4QJW B;  4QJW C;  4QJW D;  5JN3 A;  5LLN A;  5LLN B;  1JCZ B;  5SZ0 A;  4QJP B;  5SZ4 A;  5EZT X;  5BRV A;  5LLO A;  5LLO B;  5LLO C;  5LLO D;  5L6K A;  5L6K B;  2NMX B;  5SZ3 A;  1FR7 B;  2FOY B;  5DOG A;  4QSJ B;  5N0D A;  2NN1 B;  5SZ7 A;  5GMN A;  4WUQ B;  4QJO B;  4QJO C;  4QJO D;  4WUP B;  5A25 B;  5LLE A;  5FL4 B;  5FL4 C;  5FL4 D;  4KP8 B;  4KP8 C;  4KP8 D;  1KEQ B;  4KNM B;  5FL6 B;  5FL6 C;  5FL6 D;  5LLH A;  4HU1 B;  2NN7 B;  5FL5 B;  5FL5 C;  5FL5 D;  3LXE B;  3DA2 B;  3CZV B;  5GMM B;  1JV0 B;  3IAI B;  3IAI C;  3IAI D;  5L3O A;  5L3O B;  1FSQ B;  2FW4 B;  5L70 A;  5L70 B;  4CNW B;  4LP6 B;  1FSR B;  1FSN B;  2IT4 B;  1XEV B;  1XEV C;  1XEV D;  1V9E B;  1DMX B;  1DMY B;  4CNR B;  4CNR C;  4CNR D;  4Q0L B;  4Q0L C;  4Q0L D;  1J9W B;  5L6T A;  5L6T B;  3W6I E;  1RJ6 B;  1RJ5 B;  3W6H B;  5L9E B;  5L9E C;  5L9E D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling