| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 39-131 | 93 | 1-24, 145-150 | 25-38, 132-144 | 24 | 6 | slipknot |
Chain Sequence |
MLLTPEKLLEAANKQGTVPSRVRYQWMEDEETGRLKAVGYHTSMESGRDQVRVRLLKHDFPNNRYEFWEEGATGPTILWTPDNPGIELPTDTAHGEQPVIPSAIPGLEIPEMDDVSILATPMPDEKDFRDYILVFPENAFPPIYVYLSKL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 39-133 | 95 | 1-25, 142-150 | 26-38, 134-141 | 25 | 9 | slipknot | |||
| view details |
|
3.1 | 35-141 | 107 | 1-26, 145-150 | 27-34, 142-144 | 26 | 6 | slipknot | |||
| view details |
|
3.1 | 38-141 | 104 | 1-34, 143-150 | 35-37, 142-142 | 34 | 8 | slipknot |
| sequence length |
150
|
| structure length |
150
|
| publication title |
Northeast Structural Genomics Consortium Target EwR82C
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| molecule keywords |
Uncharacterized protein
|
| source organism |
Erwinia carotovora
|
| total genus |
 Genus: 28
|
| ec nomenclature | |
| pdb deposition date | 2010-04-01 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06958 | Pyocin_S | S-type Pyocin |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
