4JS6A

Crystal structure of inhibitor-free hcaii h94d
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 20-255 236 1-19, 256-258 19 3 knot
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 15x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-255 232 1-23, 256-258 23 3 knot
Fingerprint Knot forming loop Loop type
K +31 His4 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His4
probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His96 <->
Bridging ionZn301
<-> Asp94 ... His4
probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> His96 ... His4
probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> Asp94 ... His4
probabilistic
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 24-256 233 1-23, 257-257 23 1 knot
view details
2.1 24-251 228 1-23 257-257 252-256 23 1 slipknot
view details
3.1 25-255 231 256-257 1-23 24-24 23 1 slipknot
publication title Metalloprotein-Inhibitor Binding: Human Carbonic Anhydrase II as a Model for Probing Metal-Ligand Interactions in a Metalloprotein Active Site.
pubmed doi rcsb
structure length 257
molecule tags Lyase
source organism Homo sapiens
sequence length 257
molecule keywords Carbonic anhydrase 2
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2013-03-22
KnotProt deposition date 2018-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling