4KNNA

Crystal structure of human carbonic anhydrase isozyme xiii with 2-chloro-4-[(pyrimidin-2-ylsulfanyl)acetyl]benzenesulfonamide
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 22-255 234 1-21, 256-258 21 3 knot
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-232 209 1-23, 233-235 23 3 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureSer6 <-> His263
... His121 <->
Bridging ionZn301
<-> His96 ... Ser6
probabilistic
K +31
Chain closureSer6 <-> His263
... His98 <->
Bridging ionZn301
<-> His96 ... Ser6
probabilistic
K +31
Chain closureSer6 <-> His263
... His121 <->
Bridging ionZn301
<-> His98 ... Ser6
probabilistic
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-257 232 1-25, 258-258 25 1 knot
view details
2.1 25-252 228 1-24 258-258 253-257 24 1 slipknot
publication title Benzenesulfonamides with pyrimidine moiety as inhibitors of human carbonic anhydrases I, II, VI, VII, XII, and XIII
pubmed doi rcsb
structure length 258
molecule tags Lyase/lyase inhibitor
source organism Homo sapiens
sequence length 258
molecule keywords Carbonic anhydrase 13
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2013-05-10
KnotProt deposition date 2018-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling