4M8JA

Crystal structure of cait r262e bound to gamma-butyrobetaine
Slipknot S +31 41 +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 130-325 196 326-495 1-93 94-129 93 169 slipknot
view details
41 91-359 269 1-90 414-495 360-413 90 82 slipknot
Chain Sequence
GIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVETYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGADPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWK
sequence length 495
structure length 495
publication title Arginine oscillation explains Na+ independence in the substrate/product antiporter CaiT.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords L-carnitine/gamma-butyrobetaine antiporter
source organism Proteus mirabilis
ec nomenclature
pdb deposition date2013-08-13
KnotProt deposition date2014-08-19

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
A PF02028 BCCTBCCT family transporter
Image from the rcsb pdb (www.rcsb.org)
2WSWA 4M8JA 3HFXA 2WSXA
similar chains in the KnotProt database (40% sequence similarity)
2WSXB 2WSXC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 2WSW A;  4M8J A;  3HFX A;  2WSX A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 2WSX B;  2WSX C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling