4M8JA

Crystal structure of cait r262e bound to gamma-butyrobetaine
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 130-325 196 326-495 1-93 94-129 93 169 slipknot
view details
41 91-359 269 1-90 414-495 360-413 90 82 slipknot
Chain Sequence
GIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVETYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGADPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 51-367 317 1-50 405-495 368-404 50 91 slipknot
view details
4.1 78-359 282 1-2, 402-495 3-77, 360-401 2 94 slipknot
view details
4.1 78-401 324 1-2, 407-495 3-77, 402-406 2 89 slipknot
view details
3.2 52-350 299 1-6, 360-495 7-51, 351-359 6 136 slipknot
view details
3.2 37-407 371 1-18, 421-495 19-36, 408-420 18 75 slipknot
view details
3.2 40-406 367 1-20, 417-495 21-39, 407-416 20 79 slipknot
view details
3.2 40-416 377 1-36, 421-495 37-39, 417-420 36 75 slipknot
view details
3.2 54-353 300 1-51, 360-495 52-53, 354-359 51 136 slipknot
view details
3.2 89-391 303 1-71, 412-495 72-88, 392-411 71 84 slipknot
view details
3.2 87-411 325 1-71, 413-495 72-86, 412-412 71 83 slipknot
view details
4.1 91-389 299 1-77, 408-495 78-90, 390-407 77 88 slipknot
view details
4.1 91-407 317 1-88, 412-495 89-90, 408-411 88 84 slipknot
view details
4.1 94-387 294 1-77, 406-495 78-93, 388-405 77 90 slipknot
view details
3.2 94-405 312 1-90, 408-495 91-93, 406-407 90 88 slipknot
view details
2.1 113-415 303 1-89, 454-495 90-112, 416-453 89 42 slipknot
view details
2.1 106-482 377 483-495 1-89 90-105 89 12 slipknot
view details
2.1 124-342 219 1-104, 358-495 105-123, 343-357 104 138 slipknot
view details
3.1 126-327 202 1-112, 343-495 113-125, 328-342 112 153 slipknot
view details
3.1 127-419 293 1-113, 442-495 114-126, 420-441 113 54 slipknot
view details
3.1 127-483 357 484-495 1-113 114-126 113 11 slipknot
view details
2.1 136-415 280 1-116, 461-495 117-135, 416-460 116 35 slipknot
view details
2.1 136-460 325 1-116, 468-495 117-135, 461-467 116 28 slipknot
view details
2.1 136-467 332 1-116, 482-495 117-135, 468-481 116 14 slipknot
view details
2.1 137-434 298 1-135, 459-495 136-136, 435-458 135 37 slipknot
view details
2.1 137-468 332 1-135, 479-495 136-136, 469-478 135 17 slipknot
view details
2.1 136-481 346 482-495 1-124 125-135 124 13 slipknot
view details
1.1 138-343 206 1-124, 359-495 125-137, 344-358 124 137 slipknot
publication title Arginine oscillation explains Na+ independence in the substrate/product antiporter CaiT.
pubmed doi rcsb
structure length 495
molecule tags Transport protein
source organism Proteus mirabilis
sequence length 495
molecule keywords L-carnitine/gamma-butyrobetaine antiporter
ec nomenclature
pdb deposition date 2013-08-13
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02028 BCCT BCCT family transporter
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling