4XFWA

Crystal structure of the monoclinic form of alpha-carbonic anhydrase from the human pathogen helicobacter pylori
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 28-219 192 220-226 1-1 2-27 1 6 slipknot
Chain Sequence
KWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKRSAETR
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-203 176 1-27, 204-211 27 8 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureLys22 <-> Arg247
... His129 <->
Bridging ionZn301
<-> His112 ... Lys22
probabilistic
K +31
Chain closureLys22 <-> Arg247
... His129 <->
Bridging ionZn301
<-> His110 ... Lys22
probabilistic
K +31
Chain closureLys22 <-> Arg247
... His112 <->
Bridging ionZn301
<-> His110 ... Lys22
probabilistic
Chain Sequence
KWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKRSAETR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 29-223 195 1-28, 224-226 28 3 knot
view details
2.1 30-217 188 1-29 224-226 218-223 29 3 slipknot
publication title Structure of alpha-carbonic anhydrase from the human pathogen Helicobacter pylori.
pubmed doi rcsb
structure length 226
molecule tags Lyase
source organism Helicobacter pylori g27
sequence length 226
molecule keywords Alpha-carbonic anhydrase
ec nomenclature
pdb deposition date 2014-12-29
KnotProt deposition date 2018-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling