4MIVF

Crystal structure of sulfamidase, crystal form l
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-251 248 1-3 271-480 252-270 3 210 slipknot
Chain Sequence
PRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSXSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCG--QPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNE
sequence length 480
structure length 478
publication title Structure of sulfamidase provides insight into the molecular pathology of mucopolysaccharidosis IIIA
rcsb
molecule tags Hydrolase
molecule keywords N-sulphoglucosamine sulphohydrolase
source organism Homo sapiens
missing residues 164-165
ec nomenclature ec 3.10.1.1: N-sulfoglucosamine sulfohydrolase.
pdb deposition date 2013-09-02
KnotProt deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 4-258 255 1-3 269-478 259-268 3 210 slipknot
view details
2.1 6-259 254 1-3, 265-478 4-5, 260-264 3 214 slipknot
4MHXA 4MHXB 4MIVA 4MIVB 4MIVC 4MIVD 4MIVE 4MIVF 4MIVG 4MIVH
similar chains in the KnotProt database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4MHX A;  4MHX B;  4MIV A;  4MIV B;  4MIV C;  4MIV D;  4MIV E;  4MIV F;  4MIV G;  4MIV H; 
               
               
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling