4YPXA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 90-134 45 1-89, 135-249 89 115 knot
Chain Sequence
RGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLG----------ADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
sequence length 249
structure length 239
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
missing residues 166-175
ec nomenclature
pdb deposition date2015-03-13
KnotProt deposition date2016-03-16
Image from the rcsb pdb (www.rcsb.org)
4YQDA 4YVGA 4YQTA 4MCDA 4YVHA 4YQRA 3QUVA 1UALA 4YQSA 4YPXA 1UAJA 4MCBA 4MCCA 1UAKA 4H3ZA 3AXZA 4IG6A 3KNUA 1UAMA 4H3YA 3KY7A 3IEFA 1P9PA 4YVJA 4YVKA 4YVIA
similar chains in the KnotProt database (40% sequence similarity)
4YQAA 4YQ9A 3QUVB 4YQOA 4YQ5A 4YQ0A 4YQQA 4YQKA 4YQ7A 4YPZA 4YQCA 4YQGA 4YPYA 4YQ4A 4YQJA 4YQIA 4YQ8A 4YQ6A 4MCBB 5D9FA 4MCCB 4YQ1A 4YQBA 4H3ZB 4YQNA 3KNUB 3KNUC 3KNUD 4YPWA 4YQ3A 4YQLA 4H3YB 4YQPA 3IEFB 4YQ2A 4YVJB 4YVKB 4YVIB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4YQD A;  4YVG A;  4YQT A;  4MCD A;  4YVH A;  4YQR A;  3QUV A;  1UAL A;  4YQS A;  4YPX A;  1UAJ A;  4MCB A;  4MCC A;  1UAK A;  4H3Z A;  3AXZ A;  4IG6 A;  3KNU A;  1UAM A;  4H3Y A;  3KY7 A;  3IEF A;  1P9P A;  4YVJ A;  4YVK A;  4YVI A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 4YQA A;  4YQ9 A;  3QUV B;  4YQO A;  4YQ5 A;  4YQ0 A;  4YQQ A;  4YQK A;  4YQ7 A;  4YPZ A;  4YQC A;  4YQG A;  4YPY A;  4YQ4 A;  4YQJ A;  4YQI A;  4YQ8 A;  4YQ6 A;  4MCB B;  5D9F A;  4MCC B;  4YQ1 A;  4YQB A;  4H3Z B;  4YQN A;  3KNU B;  3KNU C;  3KNU D;  4YPW A;  4YQ3 A;  4YQL A;  4H3Y B;  4YQP A;  3IEF B;  4YQ2 A;  4YVJ B;  4YVK B;  4YVI B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling