5DVXA

Crystal structure of the catalytic-domain of human carbonic anhydrase ix at 1.6 angstrom resolution
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 23-248 226 1-22, 249-260 22 12 knot
Chain Sequence
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPR
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-227 204 1-23, 228-239 23 12 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis140 <-> Arg399
... His251 <->
Bridging ionZn401
<-> His228 ... His140
probabilistic
K +31
Chain closureHis140 <-> Arg399
... His251 <->
Bridging ionZn401
<-> His226 ... His140
probabilistic
K +31 His140 ... His226 <->
Bridging ionZn401
<-> His228 ...
Chain closureArg399 <-> His140
probabilistic
Chain Sequence
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 23-250 228 1-22, 251-260 22 10 knot
view details
2.1 21-247 227 1-20 252-260 248-251 20 9 slipknot
view details
3.1 26-251 226 252-260 1-22 23-25 22 8 slipknot
sequence length 260
structure length 260
publication title The Structure of Carbonic Anhydrase IX Is Adapted for Low-pH Catalysis.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 9
source organism Homo sapiens
total genus Genus: 71
ec nomenclature
pdb deposition date 2015-09-21
KnotProt deposition date 2018-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling