5JG3B

Human carbonic anhydrase ii (121t/n67q) complexed with benzo[d]thiazole-2-sulfonamide
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-256 232 1-24, 257-259 24 2 slipknot
Chain Sequence
AHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLTHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 26-255 230 1-25, 256-259 25 4 knot
Fingerprint Knot forming loop Loop type
K +31 Ala2 ... His94 <->
Bridging ionZn303
<-> His96 ...
Chain closureLys260 <-> Ala2
probabilistic
K +31 Ala2 ... His94 <->
Bridging ionZn303
<-> His119 ...
Chain closureLys260 <-> Ala2
probabilistic
K +31 Ala2 ... His96 <->
Bridging ionZn303
<-> His119 ...
Chain closureLys260 <-> Ala2
probabilistic
Chain Sequence
AHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLTHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 28-257 230 1-27, 258-259 27 2 knot
view details
2.1 27-253 227 1-26 259-259 254-258 26 1 slipknot
publication title Water-Restructuring Mutations Can Reverse the Thermodynamic Signature of Ligand Binding to Human Carbonic Anhydrase.
pubmed doi rcsb
structure length 259
molecule tags Lyase
source organism Homo sapiens
sequence length 259
molecule keywords Carbonic anhydrase 2
ec nomenclature
pdb deposition date 2016-04-19
KnotProt deposition date 2018-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling