5APGA

Structure of the sam-dependent rrna:acp-transferase tsr3 from vulcanisaeta distributa
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 45-90 46 1-44, 91-184 44 94 knot
Chain Sequence
MIPRVFIYRLPQDDPRKNTAIKLVRFGFAQLVDSIKALPSGSIILDPTVKTPLTPSDRVIAESRGLSLIDCSWKRAVDVHTKFIRGKFIRRRLPLLIAANPTHYGKPYILSTIEAVAAALYIMGFKDEAMEVLRLYKWGPNFIIINQKYLERYAAGDLSPERELLGVDDVDNGLEQLMRVLTNG
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 44-91 48 1-43, 92-184 43 93 knot
view details
3.1 46-112 67 1-43, 123-184 44-45, 113-122 43 62 slipknot
sequence length 184
structure length 184
publication title Ribosome Biogenesis Factor Tsr3 is the Aminocarboxypropyl Transferase Responsible for 18S Rrna Hypermodification in Yeast and Humans
pubmed doi rcsb
molecule tags Transferase
molecule keywords TSR3
source organism Vulcanisaeta distributa
ec nomenclature
pdb deposition date 2015-09-15
KnotProt deposition date 2016-04-27
Image from the rcsb pdb (www.rcsb.org)
5APGA
similar chains in the KnotProt database (40% sequence similarity)
5APGB 5APGC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5APG A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5APG B;  5APG C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling