5CO4A

Structural insights into the 2-oh methylation of c/u34 on trna
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 82-120 39 1-81, 121-152 81 32 knot
Chain Sequence
GPHMLHLVLYQPEIPQNAGNVARTAAALGWPLHLIRPLGFLLSSPKLKRAGLDYWPHVDLRLHDSFAAFLEALPRGARVFAFSARGEASLYEARFREGDYLLFGPESRGLPEEVLARFPTLKIPMPGPVRSLNLAVAVGVAAYEAYRQLTGR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 81-123 43 1-80, 124-152 80 29 knot
view details
2.1 80-118 39 1-79 124-152 119-123 79 29 slipknot
view details
2.1 83-123 41 124-152 1-80 81-82 80 28 slipknot
publication title Structural insights into the 2-OH methylation of C34 or U34 on tRNA
rcsb
structure length 152
molecule tags Transferase
source organism Thermus thermophilus hb27
sequence length 152
molecule keywords Putative tRNA (cytidine(34)-2'-O)-methyltransferase
ec nomenclature
pdb deposition date 2015-07-19
KnotProt deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling