5CO4A

Structural insights into the 2-oh methylation of c/u34 on trna
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 82-120 39 1-81, 121-152 81 32 knot
Chain Sequence
GPHMLHLVLYQPEIPQNAGNVARTAAALGWPLHLIRPLGFLLSSPKLKRAGLDYWPHVDLRLHDSFAAFLEALPRGARVFAFSARGEASLYEARFREGDYLLFGPESRGLPEEVLARFPTLKIPMPGPVRSLNLAVAVGVAAYEAYRQLTGR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 81-123 43 1-80, 124-152 80 29 knot
view details
2.1 80-118 39 1-79 124-152 119-123 79 29 slipknot
view details
2.1 83-123 41 124-152 1-80 81-82 80 28 slipknot
sequence length 152
structure length 152
publication title Structural insights into the 2-OH methylation of C34 or U34 on tRNA
rcsb
molecule tags Transferase
molecule keywords Putative tRNA (cytidine(34)-2'-O)-methyltransferase
source organism Thermus thermophilus hb27
ec nomenclature
pdb deposition date 2015-07-19
KnotProt deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
3N4JA 4PZKA 4PZKB 5CO4A 3N4KA 1MXIA 4JAKA 1J85A 4KGNA 4JALA 4KDZA 3E5YA
similar chains in the KnotProt database (40% sequence similarity)
5CO4B 3N4KB 4JAKB 4KGNB 4KGNC 4KGND 4KGNE 4KGNF 4KGNG 4KGNH 4JALB 3E5YB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3N4J A;  4PZK A;  4PZK B;  5CO4 A;  3N4K A;  1MXI A;  4JAK A;  1J85 A;  4KGN A;  4JAL A;  4KDZ A;  3E5Y A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5CO4 B;  3N4K B;  4JAK B;  4KGN B;  4KGN C;  4KGN D;  4KGN E;  4KGN F;  4KGN G;  4KGN H;  4JAL B;  3E5Y B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling