5EW5A

Crystal structure of colicin e9 in complex with its immunity protein im9
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 114-187 74 1-113 202-496 188-201 113 295 slipknot
Chain Sequence
AAPVAFGFPALSTPGAGGLAVSISASELSAAIAGIIAKLKK------PFGVVLSSLIPSEIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNDSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNCERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKCAMESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDDFRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELHHDKPISQGGEVYDMDNIRVTTPKRHIDIHR
sequence length 496
structure length 490
publication title Structural and biophysical analysis of nuclease protein antibiotics.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Colicin-E9
source organism Escherichia coli
missing residues 42-47
ec nomenclature
pdb deposition date2015-11-20
KnotProt deposition date2016-07-20
Image from the rcsb pdb (www.rcsb.org)
5EW5A
similar chains in the KnotProt database (40% sequence similarity)
5EW5B 5EW5C 5EW5D
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5EW5 A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5EW5 B;  5EW5 C;  5EW5 D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling