5GMBA

Methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 83-135 53 1-82, 136-171 82 36 knot
Chain Sequence
FQSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 81-137 57 1-80, 138-171 80 34 knot
view details
2.1 79-133 55 1-78 139-171 134-138 78 33 slipknot
view details
3.1 82-137 56 138-171 1-80 81-81 80 33 slipknot
sequence length 171
structure length 171
publication title Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruiginosa
rcsb
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
source organism Pseudomonas aeruginosa
ec nomenclature
pdb deposition date 2016-07-13
KnotProt deposition date 2016-10-28
Image from the rcsb pdb (www.rcsb.org)
5GMBA 5GMCA 5GM8A 3KTYA
similar chains in the KnotProt database (40% sequence similarity)
5GMCB 5GMCC 5GMCD 5GM8B 5GM8C 5GM8D 3KTYB 3KTYC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5GMB A;  5GMC A;  5GM8 A;  3KTY A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5GMC B;  5GMC C;  5GMC D;  5GM8 B;  5GM8 C;  5GM8 D;  3KTY B;  3KTY C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling