5GMCA

Methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 85-139 55 1-84, 140-174 84 35 knot
Chain Sequence
NLYFQSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 85-140 56 1-84, 141-174 84 34 knot
view details
2.1 81-136 56 1-80 143-174 137-142 80 32 slipknot
view details
3.1 86-160 75 1-84, 167-174 85-85, 161-166 84 8 slipknot
view details
2.1 86-167 82 168-174 1-84 85-85 84 6 slipknot
publication title Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruiginosa
rcsb
structure length 174
molecule tags Transferase
source organism Pseudomonas aeruginosa
sequence length 174
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
ec nomenclature
pdb deposition date 2016-07-13
KnotProt deposition date 2016-10-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling