5GOVA

Crystal structure of mcr-1, a phosphoethanolamine transferase, extracellular domain
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-248 224 1-24 276-323 249-275 24 48 slipknot
Chain Sequence
DTIYHAKDAVQATKP-MRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSA-YSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFI
sequence length 323
structure length 321
publication title Crystal Structure of Escherichia coli originated MCR-1, a phosphoethanolamine transferase for Colistin Resistance
doi rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
source organism Escherichia coli
missing residues 16, 68
ec nomenclature
pdb deposition date 2016-07-29
KnotProt deposition date 2017-01-05
Image from the rcsb pdb (www.rcsb.org)
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 23-245 223 1-22 273-321 246-272 22 49 slipknot
view details
3.1 23-272 250 1-22 274-321 273-273 22 48 slipknot
view details
2.1 20-273 254 1-9, 276-321 10-19, 274-275 9 46 slipknot
5MX9A 5K4PA 4KAVA 5GRRA 5YLCA 5YLFA 4KAYA 5LRMA 5YLEA 5GOVA 4TN0A 5LRNA
similar chains in the KnotProt database (40% sequence similarity)
6BNCA 6BNCB 5LRNB 6BNDA 6BNDB 4KAYB 5ZJVA 5GOVB 6BNFA 4TN0B 4TN0C 6BNEA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5MX9 A;  5K4P A;  4KAV A;  5GRR A;  5YLC A;  5YLF A;  4KAY A;  5LRM A;  5YLE A;  5GOV A;  4TN0 A; 
               
               
#similar chains, but unknotted
 5LRN A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6BNC A;  6BNC B;  5LRN B;  6BND A;  6BND B;  4KAY B;  5ZJV A;  5GOV B;  6BNF A;  4TN0 B;  4TN0 C;  6BNE A; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling