5HJ3C

Crystal structure of host-primed ebola virus gp, gpcl.
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 78-141 64 1-77 146-159 142-145 77 14 slipknot
Chain Sequence
RSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQA
sequence length 159
structure length 159
publication title Host-Primed Ebola Virus GP Exposes a Hydrophobic NPC1 Receptor-Binding Pocket, Revealing a Target for Broadly Neutralizing Antibodies.
pubmed doi rcsb
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein
source organism Ebola virus sp.
ec nomenclature
pdb deposition date2016-01-12
KnotProt deposition date2016-03-15
Image from the rcsb pdb (www.rcsb.org)
5HJ3C
similar chains in the KnotProt database (40% sequence similarity)
5HJ3G 5HJ3K 5HJ3O
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5HJ3 C; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5HJ3 G;  5HJ3 K;  5HJ3 O; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling