5IPZA

Crystal structure of human carbonic anhydrase isozyme iv with 5-(2-amino-1,3-thiazol-4-yl)-2-chlorobenzenesulfonamide
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 31-263 233 1-30, 264-265 30 2 knot
Chain Sequence
ESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNV----DPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS
sequence length 265
structure length 261
publication title Crystal structure of human carbonic anhydrase isozyme IV with 5-(2-amino-1,3-thiazol-4-yl)-2-chlorobenzenesulfonamide
rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 4
source organism Homo sapiens
missing residues 135-138
ec nomenclature
pdb deposition date2016-03-10
KnotProt deposition date2017-03-29
Image from the rcsb pdb (www.rcsb.org)
3FW3A 3F7BA 3F7UA 5IPZA 2ZNCA 3ZNCA 1ZNCA 5JN9A
similar chains in the KnotProt database (40% sequence similarity)
3FW3B 5JN8A 5JN8B 5JN8C 5JN8D 5JNAA 5JNAB 5JNAC 5JNAD 5JNCA 5JNCB 5JNCC 5JNCD 5JN9B 5JN9C 5JN9D 3F7BB 3F7UB 3F7UC 3F7UD 5IPZB 5IPZC 5IPZD 1ZNCB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 3FW3 A;  3F7B A;  3F7U A;  5IPZ A;  2ZNC A;  3ZNC A;  1ZNC A; 
               
               
#similar chains, but unknotted
 5JN9 A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3FW3 B;  5JN8 A;  5JN8 B;  5JN8 C;  5JN8 D;  5JNA A;  5JNA B;  5JNA C;  5JNA D;  5JNC A;  5JNC B;  5JNC C;  5JNC D;  5JN9 B;  5JN9 C;  5JN9 D;  3F7B B;  3F7U B;  3F7U C;  3F7U D;  5IPZ B;  5IPZ C;  5IPZ D;  1ZNC B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling