5J4IA

Crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution
Slipknot S +31 41
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 36-208 173 209-437 1-20 21-35 20 228 slipknot
view details
41 15-241 227 1-14 285-437 242-284 14 153 slipknot
Chain Sequence
ADAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNPYPLDAP
sequence length 437
structure length 437
publication title Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC
doi rcsb
molecule tags Transport protein
molecule keywords Arginine/agmatine antiporter
source organism Escherichia coli o157:h7
ec nomenclature
pdb deposition date2016-04-01
KnotProt deposition date2016-09-01
Image from the rcsb pdb (www.rcsb.org)
5J4IA 5J4NA 3L1LA 3OB6A 3NCYA 3LRBA 3LRCA
similar chains in the KnotProt database (40% sequence similarity)
5J4IB 5J4NB 3OB6B 3NCYB 3NCYC 3NCYD 3LRBB 3LRCB 3LRCC 3LRCD
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5J4I A;  5J4N A;  3L1L A;  3OB6 A;  3NCY A;  3LRB A;  3LRC A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5J4I B;  5J4N B;  3OB6 B;  3NCY B;  3NCY C;  3NCY D;  3LRB B;  3LRC B;  3LRC C;  3LRC D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling