5JAFA

Leut na+-free return state, c2 form at ph 5
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31 41
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-262 225 263-505 1-19 20-37 19 242 slipknot
view details
41 14-294 281 1-13 351-505 295-350 13 155 slipknot
Chain Sequence
KREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEP----TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTFEKL--KDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPTHWTVW-----ITRFYIIGLFLFLTFLVFLAERRR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 12-284 273 1-11 298-494 285-297 11 197 slipknot
view details
4.1 12-297 286 1-11 306-494 298-305 11 189 slipknot
view details
4.1 8-323 316 1-7 334-494 324-333 7 161 slipknot
view details
3.2m 13-326 314 1-12 344-494 327-343 12 151 slipknot
view details
3.2 11-343 333 1-10 345-494 344-344 10 150 slipknot
view details
3.2 9-313 305 1-2, 319-494 3-8, 314-318 2 176 slipknot
view details
1.1 22-271 250 1-16, 282-494 17-21, 272-281 16 213 slipknot
view details
3.1 29-257 229 1-17, 271-494 18-28, 258-270 17 224 slipknot
view details
2.1 33-454 422 1-17, 489-494 18-32, 455-488 17 6 slipknot
view details
2.1 42-353 312 1-18, 395-494 19-41, 354-394 18 100 slipknot
view details
2.1 42-403 362 404-494 1-18 19-41 18 90 slipknot
view details
1.1 37-241 205 1-23, 255-494 24-36, 242-254 23 240 slipknot
view details
2.1 34-278 245 1-26, 288-494 27-33, 279-287 26 207 slipknot
view details
2.1 35-261 227 1-29, 272-494 30-34, 262-271 29 223 slipknot
view details
3.1 43-271 229 1-32, 289-494 33-42, 272-288 32 206 slipknot
view details
2.1 42-257 216 1-34, 271-494 35-41, 258-270 34 224 slipknot
view details
1.1 41-270 230 1-36, 272-494 37-40, 271-271 36 223 slipknot
sequence length 505
structure length 494
publication title A conserved leucine occupies the empty substrate site of LeuT in the Na(+)-free return state.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus (strain vf5)
missing residues 128-131, 230-231, 471-475
ec nomenclature
pdb deposition date 2016-04-12
KnotProt deposition date 2016-06-03
Image from the rcsb pdb (www.rcsb.org)
2A65A 2Q72A 3F3EA 2QEIA 2Q6HA 3GJDA 2QB4A 3F4IA 3F48A 3F3AA 3F3CA 3MPNA 3GWUA 3F4JA 3MPQA 3USPA 4MMBA 3F3DA 4MMCA 3GWVA 4MMDA 3GWWA 4MMEA 3USGA 3QS5A 5JAEA 4FXZA 4MMFA 5JAGA 3QS4A 3QS6A 3USLA 2QJUA 4MM7A 3GJCA 4FY0A 5JAFA 4MM4A 4HMKA 3USMA 3TU0A 4MM9A 4MM6A 4HODA 3TT1A 4MM5A 4MM8A 3USIA 4MMAA 3TT3A 3USJA 3USOA 3USKA
similar chains in the KnotProt database (40% sequence similarity)
4MMDB 4MMEB 5JAEB 4MMFB 3GJCB 4MM4B 4HMKB 3TT1B 3USIB 3USJB 3USOB 3USKB 3USKC 3USKD
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 2A65 A;  2Q72 A;  3F3E A;  2QEI A;  2Q6H A;  3GJD A;  2QB4 A;  3F4I A;  3F48 A;  3F3A A;  3F3C A;  3MPN A;  3GWU A;  3F4J A;  3MPQ A;  3USP A;  4MMB A;  3F3D A;  4MMC A;  3GWV A;  4MMD A;  3GWW A;  4MME A;  3USG A;  3QS5 A;  5JAE A;  4FXZ A;  4MMF A;  5JAG A;  3QS4 A;  3QS6 A;  3USL A;  2QJU A;  4MM7 A;  3GJC A;  4FY0 A;  5JAF A;  4MM4 A;  4HMK A;  3USM A;  3TU0 A;  4MM9 A;  4MM6 A;  4HOD A;  3TT1 A;  4MM5 A;  4MM8 A;  3USI A;  4MMA A;  3TT3 A;  3USJ A;  3USO A;  3USK A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 4MMD B;  4MME B;  5JAE B;  4MMF B;  3GJC B;  4MM4 B;  4HMK B;  3TT1 B;  3USI B;  3USJ B;  3USO B;  3USK B;  3USK C;  3USK D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling