5JNXC

The 6.6 a cryo-em structure of the full-length human npc1 in complex with the cleaved glycoprotein of ebola virus
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 77-141 65 1-76 145-158 142-144 76 14 slipknot
Chain Sequence
RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
sequence length 158
structure length 158
publication title Structural Insights into the Niemann-Pick C1 (NPC1)-Mediated Cholesterol Transfer and Ebola Infection
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Niemann-Pick C1 protein
source organism Homo sapiens
ec nomenclature
pdb deposition date2016-05-01
KnotProt deposition date2016-06-17
Image from the rcsb pdb (www.rcsb.org)
5F1BA 5JNXC
similar chains in the KnotProt database (40% sequence similarity)
5JNXE 5JNXG
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5F1B A;  5JNX C; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5JNX E;  5JNX G; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling