5K4PA

Catalytic domain of mcr-1 phosphoethanolamine transferase
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 26-247 222 1-25 277-324 248-276 25 48 slipknot
Chain Sequence
DTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTS-AYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR
sequence length 324
structure length 323
publication title Structure of the Catalytic Domain of the Plasmid-Encoded Colistin Resistance Enzyme MCR-1 at 1.32 Angstroms Resolution
rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
missing residues 68
ec nomenclature
pdb deposition date2016-05-21
KnotProt deposition date2016-09-02
Image from the rcsb pdb (www.rcsb.org)
5K4PA 4KAVA 5GRRA 4KAYA 5LRMA 5GOVA 5LRNA
similar chains in the KnotProt database (40% sequence similarity)
5MX9A 5LRNB 4KAYB 5GOVB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5K4P A;  4KAV A;  5GRR A;  4KAY A;  5LRM A;  5GOV A; 
               
               
#similar chains, but unknotted
 5LRN A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5MX9 A;  5LRN B;  4KAY B;  5GOV B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling