5K4PA

Catalytic domain of mcr-1 phosphoethanolamine transferase
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 26-247 222 1-25 277-324 248-276 25 48 slipknot
Chain Sequence
DTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTS-AYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR
sequence length 324
structure length 323
publication title Structure of the Catalytic Domain of the Plasmid-Encoded Colistin Resistance Enzyme MCR-1 at 1.32 Angstroms Resolution
rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
missing residues 68
ec nomenclature
pdb deposition date2016-05-21
KnotProt deposition date2016-09-02
Image from the rcsb pdb (www.rcsb.org)
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 23-247 225 1-22 273-323 248-272 22 51 slipknot
view details
3.1 23-272 250 1-22 275-323 273-274 22 49 slipknot
view details
2.1 14-274 261 1-13 277-323 275-276 13 47 slipknot
view details
3.1 24-247 224 1-22, 272-323 23-23, 248-271 22 52 slipknot
view details
2.1 24-272 249 1-22, 275-323 23-23, 273-274 22 49 slipknot
5MX9A 5K4PA 4KAVA 5GRRA 5YLCA 5YLFA 4KAYA 5LRMA 5YLEA 5GOVA 4TN0A 5LRNA
similar chains in the KnotProt database (40% sequence similarity)
6BNCA 6BNCB 5LRNB 6BNDA 6BNDB 4KAYB 5ZJVA 5GOVB 6BNFA 4TN0B 4TN0C 6BNEA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5MX9 A;  5K4P A;  4KAV A;  5GRR A;  5YLC A;  5YLF A;  4KAY A;  5LRM A;  5YLE A;  5GOV A;  4TN0 A; 
               
               
#similar chains, but unknotted
 5LRN A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6BNC A;  6BNC B;  5LRN B;  6BND A;  6BND B;  4KAY B;  5ZJV A;  5GOV B;  6BNF A;  4TN0 B;  4TN0 C;  6BNE A; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling