5K6BF

Crystal structure of prefusion-stabilized rsv f single-chain 9 ds-cav1 variant.
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 30-227 198 1-29 236-442 228-235 29 207 slipknot
Chain Sequence
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNGSGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSRTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLA
sequence length 442
structure length 442
publication title Iterative structure-based improvement of a fusion-glycoprotein vaccine against RSV.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Fusion glycoprotein F0
source organism Human respiratory syncytial virus a
ec nomenclature
pdb deposition date2016-05-24
KnotProt deposition date2016-09-02
Image from the rcsb pdb (www.rcsb.org)
5K6BF 5K6CF 4ZYPA 4CCFA 3RKIA
similar chains in the KnotProt database (40% sequence similarity)
5EA4F 5C69A 5C6BF 5EA8F 5K6FF 5EA3F 4CCFB 4CCFC 4CCFD 4CCFE 4CCFF 5EA6F 5K6HF 5EA7F 5UDEF 5U68A 5U68B 5U68C 5K6IF 5TOJA 5TOJB 5TOJC 5UDCA 5UDCD 5UDCF 5K6GF 5EA5F 5TPNA 3RKIB 3RKIC 4JHWF 5TOKA 5TOKB 5TOKC 5UDDA 5UDDB 5UDDC 5UDDD 5UDDE 5UDDF 5UDDG 5UDDH 5UDDI 4ZYPB 4ZYPC
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5K6B F;  5K6C F;  4ZYP A; 
               
               
#similar chains, but unknotted
 4CCF A;  3RKI A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5EA4 F;  5C69 A;  5C6B F;  5EA8 F;  5K6F F;  5EA3 F;  4CCF B;  4CCF C;  4CCF D;  4CCF E;  4CCF F;  5EA6 F;  5K6H F;  5EA7 F;  5UDE F;  5U68 A;  5U68 B;  5U68 C;  5K6I F;  5TOJ A;  5TOJ B;  5TOJ C;  5UDC A;  5UDC D;  5UDC F;  5K6G F;  5EA5 F;  5TPN A;  3RKI B;  3RKI C;  4JHW F;  5TOK A;  5TOK B;  5TOK C;  5UDD A;  5UDD B;  5UDD C;  5UDD D;  5UDD E;  5UDD F;  5UDD G;  5UDD H;  5UDD I;  4ZYP B;  4ZYP C; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling