5N60J

Cryo-em structure of rna polymerase i in complex with rrn3 and core factor (orientation i)
Cysteine knot
Loop Piercing
view details
7-c-10-b-46-c-45 7-b-10
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
sequence length 69
structure length 69
publication title Structural Basis of RNA Polymerase I Transcription Initiation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase I subunit RPA190
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
ec nomenclature
pdb deposition date 2017-02-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling