5SYBA

Crystal structure of human phf5a
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 20-67 48 1-19, 68-90 19 23 knot
Chain Sequence
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPSTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 17-70 54 1-16, 71-90 16 20 knot
view details
3.1m 18-74 57 1-16, 89-90 17-17, 75-88 16 2 slipknot
sequence length 90
structure length 90
publication title Crystal structure of human PHF5A
rcsb
molecule tags Transcription
molecule keywords PHD finger-like domain-containing protein 5A
source organism Homo sapiens
ec nomenclature
pdb deposition date 2016-08-10
KnotProt deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
5SYBA 5IFED 5LQWY 5GM6J 2K0AA
similar chains in the KnotProt database (40% sequence similarity)
5SYBB 6EN4D 6G90S 5O9Zy 5NRLS
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5SYB A;  5IFE D;  5LQW Y;  5GM6 J;  2K0A A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5SYB B;  6EN4 D;  6G90 S;  5O9Z y;  5NRL S; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling