5SYBA

Crystal structure of human phf5a
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 20-67 48 1-19, 68-90 19 23 knot
Chain Sequence
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPSTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 17-70 54 1-16, 71-90 16 20 knot
view details
3.1m 18-74 57 1-16, 89-90 17-17, 75-88 16 2 slipknot
publication title Crystal structure of human PHF5A
rcsb
structure length 90
molecule tags Transcription
source organism Homo sapiens
sequence length 90
molecule keywords PHD finger-like domain-containing protein 5A
ec nomenclature
pdb deposition date 2016-08-10
KnotProt deposition date 2016-09-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling