5SYBA

Crystal structure of human phf5a
Knot K -31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
-31 20-67 48 1-19, 68-90 19 23 knot
Chain Sequence
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPSTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
sequence length 90
structure length 90
publication title Crystal structure of human PHF5A
rcsb
molecule tags Transcription
molecule keywords PHD finger-like domain-containing protein 5A
source organism Homo sapiens
ec nomenclature
pdb deposition date2016-08-10
KnotProt deposition date2016-09-09
Image from the rcsb pdb (www.rcsb.org)
5SYBA 5IFED 5LQWY 5GM6J 2K0AA
similar chains in the KnotProt database (40% sequence similarity)
5SYBB 5O9Zy 5NRLS
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5SYB A;  5IFE D;  5LQW Y;  5GM6 J;  2K0A A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5SYB B;  5O9Z y;  5NRL S; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling