5T89V

Crystal structure of vegf-a in complex with vegfr-1 domains d1-6
Cysteine knot
Loop Piercing
view details
57-c-61-b-104-c-102 26-b-68
Chain Sequence
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKK
sequence length 96
structure length 96
publication title Structure of the Full-length VEGFR-1 Extracellular Domain in Complex with VEGF-A.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Vascular endothelial growth factor A
source organism Homo sapiens
ec nomenclature
pdb deposition date 2016-09-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling