5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 17-265 249 1-16, 266-388 16 123 knot
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIA---------DLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
sequence length 388
structure length 379
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
missing residues 104-112
ec nomenclature
pdb deposition date2016-09-08
KnotProt deposition date2016-10-03
Image from the rcsb pdb (www.rcsb.org)
5A1IA 2P02A 4ODJA 5T8SA 3S82A 3TDEA 4LE5A 2OBVA 3RV2A 5T8TA 4NDNA 4NDNB 4NDNC 4NDND 3IMLA 5H9UA 1RG9A 1P7LA 1MXAA 4KTTA 4KTTB 4KTTC 4KTTD 1MXBA 1MXCA 1QM4A 1XRBA 1XRAA 1XRCA 4KTVA 4KTVB 4KTVC 4KTVD 1FUGA 3SO4A 1O9TA 1O90A 1O92A 1O93A
similar chains in the KnotProt database (40% sequence similarity)
5T8SB 5A1GA 3S82B 3TDEB 3TDEC 3TDED 4LE5B 3RV2B 5UGHA 5UGHB 5UGHC 5UGHD 5T8TB 5A19A 3IMLB 3IMLC 3IMLD 5H9UB 5H9UC 5H9UD 1RG9B 1RG9C 1RG9D 1P7LB 1P7LC 1P7LD 1QM4B 1FUGB 3SO4B 3SO4C 3SO4D 1O9TB 1O90B 1O92B 1O93B
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5A1I A;  2P02 A;  4ODJ A;  5T8S A;  3S82 A;  3TDE A;  4LE5 A;  2OBV A;  3RV2 A;  5T8T A;  4NDN A;  4NDN B;  4NDN C;  4NDN D;  3IML A;  5H9U A;  1RG9 A;  1P7L A;  1MXA A;  4KTT A;  4KTT B;  4KTT C;  4KTT D;  1MXB A;  1MXC A;  1QM4 A;  1XRB A;  1XRA A;  1XRC A;  4KTV A;  4KTV B;  4KTV C;  4KTV D;  1FUG A;  3SO4 A;  1O9T A;  1O90 A;  1O92 A;  1O93 A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5T8S B;  5A1G A;  3S82 B;  3TDE B;  3TDE C;  3TDE D;  4LE5 B;  3RV2 B;  5UGH A;  5UGH B;  5UGH C;  5UGH D;  5T8T B;  5A19 A;  3IML B;  3IML C;  3IML D;  5H9U B;  5H9U C;  5H9U D;  1RG9 B;  1RG9 C;  1RG9 D;  1P7L B;  1P7L C;  1P7L D;  1QM4 B;  1FUG B;  3SO4 B;  3SO4 C;  3SO4 D;  1O9T B;  1O90 B;  1O92 B;  1O93 B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling