5TWJA

Crystal structure of rlmh in complex with s-adenosylmethionine
Knot K +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 73-121 49 1-72, 122-157 72 36 knot
Chain Sequence
HHVKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
sequence length 157
structure length 157
publication title Small methyltransferase RlmH assembles a composite active site to methylate a ribosomal pseudouridine.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Ribosomal RNA large subunit methyltransferase H
source organism Escherichia coli
ec nomenclature
pdb deposition date2016-11-14
KnotProt deposition date2017-05-06
Image from the rcsb pdb (www.rcsb.org)
1NS5A 5TWKA 5TWJA
similar chains in the KnotProt database (40% sequence similarity)
1NS5B 5TWKB 5TWKC 5TWKD 5TWJB 5TWJC 5TWJD
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 1NS5 A;  5TWK A;  5TWJ A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1NS5 B;  5TWK B;  5TWK C;  5TWK D;  5TWJ B;  5TWJ C;  5TWJ D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling