5TWJA

Crystal structure of rlmh in complex with s-adenosylmethionine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 73-121 49 1-72, 122-157 72 36 knot
Chain Sequence
HHVKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 73-122 50 1-72, 123-157 72 35 knot
publication title Small methyltransferase RlmH assembles a composite active site to methylate a ribosomal pseudouridine.
pubmed doi rcsb
structure length 157
molecule tags Transferase
source organism Escherichia coli
sequence length 157
molecule keywords Ribosomal RNA large subunit methyltransferase H
ec nomenclature
pdb deposition date 2016-11-14
KnotProt deposition date 2017-05-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling