5TWKA

Crystal structure of rlmh in complex with sinefungin
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 73-121 49 1-72, 122-157 72 36 knot
Chain Sequence
HHVKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 72-123 52 1-71, 124-157 71 34 knot
view details
2.1 70-119 50 1-69 125-157 120-124 69 33 slipknot
view details
3.1 73-123 51 124-157 1-71 72-72 71 33 slipknot
sequence length 157
structure length 157
publication title Small methyltransferase RlmH assembles a composite active site to methylate a ribosomal pseudouridine.
pubmed doi rcsb
molecule tags Transferase/antibiotic
molecule keywords Ribosomal RNA large subunit methyltransferase H
source organism Escherichia coli
ec nomenclature
pdb deposition date 2016-11-14
KnotProt deposition date 2017-05-03
Image from the rcsb pdb (www.rcsb.org)
1NS5A 5TWKA 5TWJA
similar chains in the KnotProt database (40% sequence similarity)
1NS5B 5TWKB 5TWKC 5TWKD 5TWJB 5TWJC 5TWJD
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 1NS5 A;  5TWK A;  5TWJ A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1NS5 B;  5TWK B;  5TWK C;  5TWK D;  5TWJ B;  5TWJ C;  5TWJ D; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling