5WYRA

Crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 90-133 44 1-89, 134-248 89 115 knot
Chain Sequence
SMLWVGVVSIFPEMFRAISDYGITSRAVKQGLLTLTCWNPRVYTEDRHQTVDDRPFGGGPGMVMKIKPLEGALADARQAAGGRKAKVIYLSPQGRQLTQAGVRELAEEEALILIAGRYEGIDERFIEEHVDEEWSIGDYVLSGGELPAMVLVDAVTRLLPGALG------EDSFTDGLLDCPHYTRPEVYADKRVPEVLLSGNHEHIRRWRLQQALGRTWERRADLLDSRSLSGEEQKLLAEYIRQRD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 89-134 46 1-88, 135-242 88 108 knot
view details
2.1 86-131 46 1-85 137-242 132-136 85 106 slipknot
view details
2.1 91-168 78 1-88, 177-242 89-90, 169-176 88 66 slipknot
view details
2.1 91-192 102 1-88, 205-242 89-90, 193-204 88 38 slipknot
view details
2.1 91-205 115 1-88, 233-242 89-90, 206-232 88 10 slipknot
missing residues 165-170
publication title Crystal Structure and catalytic mechanism of TrmD from Pseudomonas aeruginosa, a m1G37 tRNA methyltransferase essential for bacterial survival
rcsb
structure length 242
molecule tags Transferase
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
sequence length 248
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
ec nomenclature
pdb deposition date 2017-01-15
KnotProt deposition date 2017-12-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling