5YLEA

Mcr-1 complex with ethanolamine (eta)
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 29-249 221 1-28 278-331 250-277 28 54 slipknot
Chain Sequence
PKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTS-AYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIRLEHHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 18-247 230 1-17 253-330 248-252 17 78 slipknot
view details
3.1 27-249 223 1-26 276-330 250-275 26 55 slipknot
view details
2.1 13-275 263 1-12 279-330 276-278 12 52 slipknot
view details
2.1 24-275 252 1-13, 277-330 14-23, 276-276 13 54 slipknot
view details
3.1 23-276 254 1-14, 278-330 15-22, 277-277 14 53 slipknot
sequence length 331
structure length 330
publication title Substrate analog interaction with MCR-1 offers insight into the rising threat of the plasmid-mediated transferable colistin resistance.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
source organism Escherichia coli
missing residues 70
ec nomenclature
pdb deposition date 2017-10-17
KnotProt deposition date 2017-11-08
Image from the rcsb pdb (www.rcsb.org)
5MX9A 5K4PA 4KAVA 5GRRA 5YLCA 5YLFA 4KAYA 5LRMA 5YLEA 5GOVA 4TN0A 5LRNA
similar chains in the KnotProt database (40% sequence similarity)
6BNCA 6BNCB 5LRNB 6BNDA 6BNDB 4KAYB 5ZJVA 5GOVB 6BNFA 4TN0B 4TN0C 6BNEA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5MX9 A;  5K4P A;  4KAV A;  5GRR A;  5YLC A;  5YLF A;  4KAY A;  5LRM A;  5YLE A;  5GOV A;  4TN0 A; 
               
               
#similar chains, but unknotted
 5LRN A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6BNC A;  6BNC B;  5LRN B;  6BND A;  6BND B;  4KAY B;  5ZJV A;  5GOV B;  6BNF A;  4TN0 B;  4TN0 C;  6BNE A; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling