5YLEA

Mcr-1 complex with ethanolamine (eta)
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 29-249 221 1-28 278-331 250-277 28 54 slipknot
Chain Sequence
PKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTS-AYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIRLEHHH
sequence length 331
structure length 330
publication title Substrate analog interaction with MCR-1 offers insight into the rising threat of the plasmid-mediated transferable colistin resistance.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
source organism Escherichia coli
missing residues 70
ec nomenclature
pdb deposition date2017-10-17
KnotProt deposition date2017-11-08
Image from the rcsb pdb (www.rcsb.org)
5MX9A 5K4PA 4KAVA 5GRRA 5YLCA 5YLFA 4KAYA 5LRMA 5YLEA 5GOVA 5LRNA
similar chains in the KnotProt database (40% sequence similarity)
5LRNB 4KAYB 5GOVB
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 5MX9 A;  5K4P A;  4KAV A;  5GRR A;  5YLC A;  5YLF A;  4KAY A;  5LRM A;  5YLE A;  5GOV A; 
               
               
#similar chains, but unknotted
 5LRN A;                               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5LRN B;  4KAY B;  5GOV B; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling