6AWNA

X-ray structure of the s439t human serotonin transporter complexed with paroxetine at the central site
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 42-273 232 1-24, 544-544 25-41, 274-543 24 1 slipknot
view details
41 19-305 287 1-18 364-544 306-363 18 181 slipknot
Chain Sequence
GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 15-301 287 1-14 313-544 302-312 14 232 slipknot
view details
4.1 16-311 296 1-15 325-544 312-324 15 220 slipknot
view details
4.1 16-324 309 1-15 338-544 325-337 15 207 slipknot
view details
3.2 23-348 326 1-4, 364-544 5-22, 349-363 4 181 slipknot
view details
2.1 25-276 252 1-19, 286-544 20-24, 277-285 19 259 slipknot
view details
2.1 26-384 359 1-20, 397-544 21-25, 385-396 20 148 slipknot
view details
2.1 45-425 381 426-544 1-20 21-44 20 118 slipknot
view details
2.1 46-369 324 1-21, 409-544 22-45, 370-408 21 136 slipknot
view details
1.1 40-293 254 1-22, 308-544 23-39, 294-307 22 237 slipknot
view details
2.1 38-271 234 1-23, 292-544 24-37, 272-291 23 253 slipknot
view details
1.1 34-259 226 1-27, 269-544 28-33, 260-268 27 276 slipknot
view details
1.1 45-291 247 1-30, 309-544 31-44, 292-308 30 236 slipknot
view details
1.1 42-257 216 1-33, 273-544 34-41, 258-272 33 272 slipknot
view details
2.1 42-411 370 1-34, 417-544 35-41, 412-416 34 128 slipknot
view details
2.1 45-274 230 1-38, 288-544 39-44, 275-287 38 257 slipknot
publication title Structural basis for recognition of diverse antidepressants by the human serotonin transporter
rcsb
structure length 544
molecule tags Transport protein
source organism Homo sapiens
sequence length 544
molecule keywords Sodium-dependent serotonin transporter
ec nomenclature
pdb deposition date 2017-09-06
KnotProt deposition date 2017-10-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling