6AWOA

X-ray structure of the ts3 human serotonin transporter complexed with sertraline at the central site
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 42-276 235 277-544 1-24 25-41 24 267 slipknot
view details
41 22-305 284 1-21 365-544 306-364 21 180 slipknot
Chain Sequence
GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 16-302 287 1-15 313-544 303-312 15 232 slipknot
view details
4.1 15-313 299 1-14 351-544 314-350 14 194 slipknot
view details
3.2 13-350 338 1-12 365-544 351-364 12 180 slipknot
view details
3.2 16-348 333 1-12, 356-544 13-15, 349-355 12 189 slipknot
view details
3.2 16-355 340 1-12, 365-544 13-15, 356-364 12 180 slipknot
view details
4.1 22-343 322 1-14, 362-544 15-21, 344-361 14 183 slipknot
view details
4.1 21-361 341 1-15, 364-544 16-20, 362-363 15 181 slipknot
view details
3.2m 23-343 321 1-21, 362-544 22-22, 344-361 21 183 slipknot
view details
3.2m 19-339 321 1-14, 344-544 15-18, 340-343 14 201 slipknot
view details
2.1 46-369 324 1-21, 407-544 22-45, 370-406 21 138 slipknot
view details
2.1 46-432 387 433-544 1-21 22-45 21 111 slipknot
view details
2.1 34-275 242 1-22, 289-544 23-33, 276-288 22 256 slipknot
view details
1.1 40-258 219 1-26, 272-544 27-39, 259-271 26 273 slipknot
view details
1.1 46-293 248 1-30, 306-544 31-45, 294-305 30 239 slipknot
view details
2.1 44-417 374 1-37, 430-544 38-43, 418-429 37 115 slipknot
publication title Structural basis for recognition of diverse antidepressants by the human serotonin transporter
rcsb
structure length 544
molecule tags Transport protein
source organism Homo sapiens
sequence length 544
molecule keywords Sodium-dependent serotonin transporter
ec nomenclature
pdb deposition date 2017-09-06
KnotProt deposition date 2017-10-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling