6AWPA

X-ray structure of the ts3 human serotonin transporter complexed with fluvoxamine at the central site
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 42-276 235 277-544 1-24 25-41 24 267 slipknot
view details
41 19-305 287 1-18 367-544 306-366 18 178 slipknot
Chain Sequence
GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 16-301 286 1-15 312-544 302-311 15 233 slipknot
view details
4.1 15-313 299 1-14 337-544 314-336 14 208 slipknot
view details
4.1 12-341 330 1-11 352-544 342-351 11 193 slipknot
view details
3.2 14-347 334 1-13 365-544 348-364 13 180 slipknot
view details
3.2 19-341 323 1-11, 362-544 12-18, 342-361 11 183 slipknot
view details
3.2 19-361 343 1-13, 365-544 14-18, 362-364 13 180 slipknot
view details
3.2 17-335 319 1-11, 342-544 12-16, 336-341 11 203 slipknot
view details
2.1 43-272 230 1-19, 290-544 20-42, 273-289 19 255 slipknot
view details
2.1 43-370 328 1-21, 407-544 22-42, 371-406 21 138 slipknot
view details
2.1 46-424 379 1-22, 509-544 23-45, 425-508 22 36 slipknot
view details
1.1 37-293 257 1-27, 309-544 28-36, 294-308 27 236 slipknot
view details
1.1 40-258 219 1-28, 273-544 29-39, 259-272 28 272 slipknot
view details
1.1 42-258 217 1-39, 273-544 40-41, 259-272 39 272 slipknot
view details
1.1 45-293 249 1-36, 309-544 37-44, 294-308 36 236 slipknot
view details
2.1 43-289 247 1-31, 294-544 32-42, 290-293 31 251 slipknot
view details
1.1 43-259 217 1-41, 267-544 42-42, 260-266 41 278 slipknot
view details
2.1 44-286 243 1-42, 293-544 43-43, 287-292 42 252 slipknot
publication title Structural basis for recognition of diverse antidepressants by the human serotonin transporter
rcsb
structure length 544
molecule tags Transport protein
source organism Homo sapiens
sequence length 544
molecule keywords Sodium-dependent serotonin transporter
ec nomenclature
pdb deposition date 2017-09-06
KnotProt deposition date 2017-10-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling