6AWQA

Anomalous chloride signal reveals the position of sertraline complexed with the serotonin transporter at the central site
Slipknot S +31 41 +31
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 42-276 235 277-544 1-24 25-41 24 267 slipknot
view details
41 19-305 287 1-18 367-544 306-366 18 178 slipknot
Chain Sequence
GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETP
sequence length 544
structure length 544
publication title Structural basis for recognition of diverse antidepressants by the human serotonin transporter
rcsb
molecule tags Transport protein
molecule keywords Sodium-dependent serotonin transporter
source organism Homo sapiens
ec nomenclature
pdb deposition date2017-09-06
KnotProt deposition date2017-10-25
Image from the rcsb pdb (www.rcsb.org)
4XP9C 4XP1A 4XP4A 4M48A 4XNXA 4XNUA 4XPAA 4XPHA 4XP6A 4XPBA 4XPTA 4XPFA 4XPGA 4XP5A 6AWNA 6AWOA 6AWPA 6AWQA
similar chains in the KnotProt database (40% sequence similarity)
5I6XA 5I71A 5I73A 5I74A 5I75A 5I6ZA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4XP9 C;  4XP1 A;  4XP4 A;  4M48 A;  4XNX A;  4XNU A;  4XPA A;  4XPH A;  4XP6 A;  4XPB A;  4XPT A;  4XPF A;  4XPG A;  4XP5 A;  6AWN A;  6AWO A;  6AWP A;  6AWQ A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5I6X A;  5I71 A;  5I73 A;  5I74 A;  5I75 A;  5I6Z A; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling