6AWQA

Anomalous chloride signal reveals the position of sertraline complexed with the serotonin transporter at the central site
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 42-276 235 277-544 1-24 25-41 24 267 slipknot
view details
41 19-305 287 1-18 367-544 306-366 18 178 slipknot
Chain Sequence
GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5



Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 15-301 287 1-14 314-544 302-313 14 231 slipknot
view details
4.1 16-313 298 1-15 329-544 314-328 15 216 slipknot
view details
4.1 16-328 313 1-15 339-544 329-338 15 206 slipknot
view details
4.1 10-338 329 1-9 353-544 339-352 9 192 slipknot
view details
4.1 16-348 333 1-15 362-544 349-361 15 183 slipknot
view details
4.1 16-361 346 1-15 365-544 362-364 15 180 slipknot
view details
3.2 18-348 331 1-15, 362-544 16-17, 349-361 15 183 slipknot
view details
3.2 24-338 315 1-16, 349-544 17-23, 339-348 16 196 slipknot
view details
3.2 23-335 313 1-17, 339-544 18-22, 336-338 17 206 slipknot
view details
1.1 26-287 262 1-20, 297-544 21-25, 288-296 20 248 slipknot
view details
2.1 43-369 327 1-20, 410-544 21-42, 370-409 20 135 slipknot
view details
2.1 46-483 438 484-544 1-21 22-45 21 60 slipknot
view details
2.1 43-272 230 1-27, 288-544 28-42, 273-287 27 257 slipknot
view details
1.1 42-258 217 1-28, 268-544 29-41, 259-267 28 277 slipknot
view details
1.1 45-290 246 1-31, 308-544 32-44, 291-307 31 237 slipknot
view details
1.1 39-267 229 1-32, 273-544 33-38, 268-272 32 272 slipknot
view details
2.1 42-414 373 1-36, 421-544 37-41, 415-420 36 124 slipknot
sequence length 544
structure length 544
publication title Structural basis for recognition of diverse antidepressants by the human serotonin transporter
rcsb
molecule tags Transport protein
molecule keywords Sodium-dependent serotonin transporter
source organism Homo sapiens
ec nomenclature
pdb deposition date 2017-09-06
KnotProt deposition date 2017-10-25
Image from the rcsb pdb (www.rcsb.org)
4XP9C 4XP1A 4XP4A 4M48A 4XNXA 4XNUA 4XPAA 4XPHA 4XP6A 4XPBA 4XPTA 4XPFA 4XPGA 4XP5A 6AWNA 6AWOA 6AWPA 6AWQA
similar chains in the KnotProt database (40% sequence similarity)
5I6XA 5I71A 5I73A 5I74A 5I75A 5I6ZA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the KnotProt database (40% sequence similarity)
 4XP9 C;  4XP1 A;  4XP4 A;  4M48 A;  4XNX A;  4XNU A;  4XPA A;  4XPH A;  4XP6 A;  4XPB A;  4XPT A;  4XPF A;  4XPG A;  4XP5 A;  6AWN A;  6AWO A;  6AWP A;  6AWQ A; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5I6X A;  5I71 A;  5I73 A;  5I74 A;  5I75 A;  5I6Z A; 
           

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling