6EKIA

Structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 26-219 194 1-25, 220-222 25 2 slipknot
Chain Sequence
HWSYHGETGPQHWGDLKNEYIMCKIGKNQSPVDISRIVEAELEKIKINYSSGGSSITNNGHTIKVSYEPGSYIIVDGIRFELKQFHFHAPSEHTIKGKSYPFEAHFVHADKDGNLAVIGVIFKEGKKNPIIEKIWENLPEAGKTIKLAHKINAYDLLPKKKKYYRYSGSLTTPPCSEGVRWIVMEEEMELSKEQIEKFRKLMGGDTNRPVQPLNARMIMEMD
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-201 175 1-26, 202-205 26 4 knot
Fingerprint Knot forming loop Loop type
K +31 His32 ... His117 <->
Bridging ionZn301
<-> His136 ...
Chain closureAsp253 <-> His32
probabilistic
K +31
Chain closureHis32 <-> Asp253
... His119 <->
Bridging ionZn301
<-> His117 ... His32
probabilistic
K +31 His32 ... His119 <->
Bridging ionZn301
<-> His136 ...
Chain closureAsp253 <-> His32
probabilistic
Chain Sequence
HWSYHGETGPQHWGDLKNEYIMCKIGKNQSPVDISRIVEAELEKIKINYSSGGSSITNNGHTIKVSYEPGSYIIVDGIRFELKQFHFHAPSEHTIKGKSYPFEAHFVHADKDGNLAVIGVIFKEGKKNPIIEKIWENLPEAGKTIKLAHKINAYDLLPKKKKYYRYSGSLTTPPCSEGVRWIVMEEEMELSKEQIEKFRKLMGGDTNRPVQPLNARMIMEMD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 28-221 194 1-27, 222-222 27 1 knot
view details
2.1 29-217 189 1-28 222-222 218-221 28 1 slipknot
publication title Structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney.
pubmed doi rcsb
structure length 222
molecule tags Lyase
source organism Persephonella marina
sequence length 222
molecule keywords Carbonic anhydrase
ec nomenclature
pdb deposition date 2017-09-26
KnotProt deposition date 2018-10-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling