Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
+31 30-256 227 1-29, 257-260 29 4 knotted
Chain Sequence
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAXPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling