Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-258 234 259-260 1-1 2-24 1 1 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureAla1 <-> Phe260
... His96 <->
Bridging ionZn261
<-> His94 ... Ala1
probabilistic
K +31 Ala1 ... His96 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Ala1
probabilistic
K +31 Ala1 ... His94 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Ala1
probabilistic
Chain Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling