Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 3-236 234 1-2, 237-238 2 2 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGly25 <-> Leu262
... Gln173 <->
Bridging ionK305
<-> Asp171 ... Gly25		 probabilistic
K +31
Chain closureGly25 <-> Leu262
... His119 <->
Bridging ionZn280
<-> His96 ... Gly25		 probabilistic
Chain Sequence
GTRQSPINIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGYAFQVEFDDSCEDSGISGGPLGNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENCKKASVGENGLAVIGVFLKLGAHHQALQKLVDVLPEVRHKDTQVAMGPFDPSCLMPACRDYWTYPGSLTTPPLAESVTWIVQKTPVEVSPSQLSMFRTLLFSGRGEEEDVMVNNYRPLQPLRDRKLRSSFRL
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling