Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-204 177 1-27, 205-212 27 8 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureThr21 <-> Arg247
... His129 <->
Bridging ionZn301
<-> His112 ... Thr21		 probabilistic
K +31
Chain closureThr21 <-> Arg247
... His129 <->
Bridging ionZn301
<-> His110 ... Thr21		 probabilistic
K +31
Chain closureThr21 <-> Arg247
... His112 <->
Bridging ionZn301
<-> His110 ... Thr21		 probabilistic
Chain Sequence
TKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQ---DLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling