Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 4-c-12-b-25-c-20 | 19-b-36 |
Chain Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
|
sequence length |
48
|
structure length |
48
|
publication title |
The solution structure of omega-Aga-IVB, a P-type calcium channel antagonist from venom of the funnel web spider, Agelenopsis aperta.
pubmed doi rcsb |
molecule tags |
Neurotoxin
|
molecule keywords |
OMEGA-AGATOXIN-IVB
|
ec nomenclature | |
pdb deposition date | 1995-11-03 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Omega-AgatoxinV | Omega-AgatoxinV |
#chains in the KnotProt database with same CATH superfamily 1IVA A; 1AGG A; 1OAV A; 1OAW A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A; #chains in the KnotProt database with same CATH topology 1IVA A; 2DCW A; 1CIX A; 1AGG A; 1OAV A; 1OAW A; 2DCV A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A; #chains in the KnotProt database with same CATH homology 1IVA A; 2DCW A; 1CIX A; 1AGG A; 1OAV A; 1OAW A; 2DCV A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...