| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 38-181 | 144 | 1-33, 221-293 | 34-37, 182-220 | 33 | 73 | slipknot |
Chain Sequence |
KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1m | 7-177 | 171 | 1-1, 185-293 | 2-6, 178-184 | 1 | 109 | slipknot | |||
| view details |
|
2.1m | 27-178 | 152 | 1-22, 185-293 | 23-26, 179-184 | 22 | 109 | slipknot | |||
| view details |
|
2.1m | 41-175 | 135 | 1-30, 188-293 | 31-40, 176-187 | 30 | 106 | slipknot | |||
| view details |
|
2.1m | 41-212 | 172 | 1-31, 226-293 | 32-40, 213-225 | 31 | 68 | slipknot |
| sequence length |
293
|
| structure length |
293
|
| publication title |
Crystallographic structure and functional interpretation of the cytoplasmic domain of erythrocyte membrane band 3.
pubmed rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
BAND 3 ANION TRANSPORT PROTEIN
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 86
|
| ec nomenclature | |
| pdb deposition date | 2001-01-20 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| P | PF00955 | HCO3_cotransp | HCO3- transporter family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Mannitol-specific EII; Chain A | Mannitol-specific EII; Chain A |
#chains in the KnotProt database with same CATH superfamily 1HYN P; #chains in the KnotProt database with same CATH topology 1HYN P; #chains in the KnotProt database with same CATH homology 1HYN P;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
